(data stored in ACNUC29543 zone)

EMBL: CP000521.PE371

CP000521.PE371       Location/Qualifiers
FT   CDS_pept        421968..422348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10848"
FT                   /db_xref="GOA:A3M1Q4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1Q4"
FT                   /protein_id="ABO10848.2"
FT                   /translation="MYYPLLSIALGSVLGAWLRWFLGLKLNPIYPQIPLGTVTVNLVGG
FT                   FIIGFAMAYFAHSDLSPNYKLFVITGFCGALTTFSTFSIEIVTLLQSGKWGMAMLAISI
FT                   HLIGSLIFTCLGLAAYYWVAGH"
     atgtattatc ctttactttc aattgcctta ggttcagttc ttggggcgtg gttgcgttgg        60
     tttttaggtt taaaactgaa cccgatttat ccgcaaattc cgttgggtac ggttactgtt       120
     aatttggtcg gtggctttat tattggtttt gcgatggctt attttgctca tagtgatttg       180
     agtccgaact ataagctttt tgtgattacc ggtttttgtg gtgctttaac tacattctca       240
     actttctcaa ttgagatcgt caccttattg caaagtggta agtggggaat ggcaatgttg       300
     gccatttcta ttcatttaat tgggtcgtta atttttacgt gtttggggtt ggcggcttat       360
     tattgggtag cggggcattg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page