(data stored in ACNUC29543 zone)

EMBL: CP000521.PE391

CP000521.PE391       Location/Qualifiers
FT   CDS_pept        complement(448854..451148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0413"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10868"
FT                   /protein_id="ABO10868.2"
FT                   /translation="MSNMQLDTLRRIVQEINASVSLHESLDIMVNQVAEAMKVDVCSIY
FT                   LLDERNQRYVLMASKGLNPESVGHVSLQLGEGLVGLVGQREEIVNLDNAPKHERFLYLP
FT                   ETGEEIYNSFLGVPVMYRRKVMGVLVVQNRLPQDFSEAAESFLVTLCAQLSGVIAHAHA
FT                   VGNIDVFRKPSNGPAYKTFQGVSGAGGVALGRAIILYPPADLGSVPDREAEDISDELRI
FT                   LDQAISSVRSEIRSLDEKMHDSLMAEERALFSVFLRMLDENALPAEIKELIRDGHWAQG
FT                   AVRRVIEKHTALFAQMEDDYLRERVSDLKDLGRRILAYLQEEDSSHRELSPDSILIGEE
FT                   ISTAALVELPVDNIAAIVTSEGAANSHMVIVARALGIPTVVGVTELPVNTLDDAEMIVD
FT                   AYQGRVFVNPPRRLRQRYKEIQKEDEQIAKDLKQYETKEAITPDGVSVQLFVNTGLMID
FT                   VVRGVQRGAQGVGLYRSEIPFMLRERFPGEEEQRAIYRQQLSHFANKPVVMRTLDIGAD
FT                   KDLPYFSIEEENSALGWRGIRFTLDHPEIFSAQIRAMLKASIGLNNLHILLPMVTTVSE
FT                   VEEVLYLLERDWIAVQEEEQVKITKPKIGIMVEVPSVLLQIDEFAELVDFFSVGSNDLT
FT                   QYLLAVDRNNPHVANVYSHFHPSILRALTRLVKECHKYQKPVSICGEMAGDPLSAILLM
FT                   AMGFNTLSMSSSNILRVRKAICHVPMSDAQKLLDDVMKMNNPLIVKSWLEYYFKTHGLA
FT                   DMVKSNRLVSV"
     atgtcaaaca tgcaactcga cactctaaga cgcattgtcc aagagattaa tgcgtccgtg        60
     agtttgcatg aatcgttaga cattatggtc aatcaggttg ctgaggccat gaaagtggat       120
     gtttgctcta tttatttact cgatgaacgc aatcaacgtt atgtattgat ggcctcaaaa       180
     ggcttaaatc cagaatctgt tgggcatgtt tcattgcagt taggtgaagg cttggtgggt       240
     ctggttgggc aacgtgaaga aattgttaac cttgacaatg cgccaaagca cgaacgcttt       300
     ttgtatttac ctgaaacggg cgaagaaatt tataactcat tccttggcgt acccgtcatg       360
     tatcgccgta aggttatggg tgttttagtt gtccaaaatc gacttcctca agattttagt       420
     gaagcggccg aatcattttt agtcacctta tgtgcacagc tctcaggtgt tattgcacat       480
     gcgcatgcgg ttggaaatat tgatgtattt cgtaagccaa gcaatgggcc tgcctataag       540
     accttccaag gcgtttccgg tgcaggtggg gtggctttag gtcgcgctat tattttatat       600
     ccacctgccg acttaggttc agtacctgac cgtgaagcag aagatatcag cgatgaactc       660
     cgcattttag atcaagctat ttcatcggta cgttcagaga ttcgttcttt agatgaaaaa       720
     atgcatgact cgctcatggc agaagaacgt gctttgttta gcgtattctt aagaatgcta       780
     gatgaaaatg ccttaccggc agaaattaaa gaactgatcc gcgatgggca ttgggcacaa       840
     ggtgcggtgc gccgtgtaat tgaaaaacac actgccctat ttgcacaaat ggaggacgat       900
     tatcttcgtg aacgcgtttc tgaccttaaa gacttagggc gacgtattct agcgtactta       960
     caagaagaag attcgagcca ccgtgaactt agcccagaca gtattttaat tggtgaagaa      1020
     attagtaccg ctgcgctagt agaattaccg gtagataata tcgcagcgat tgtgacgtca      1080
     gaaggcgcag ccaattcgca tatggtgatt gttgcccgtg cattagggat tccaacggtg      1140
     gtcggcgtaa ccgaactgcc tgtaaatacg cttgatgatg cagaaatgat tgtggatgcc      1200
     tatcagggcc gtgtttttgt aaaccctcca cgtcgtttac gtcaacgtta taaagaaatt      1260
     caaaaagaag acgagcaaat cgcaaaagat ctcaaacaat atgagaccaa agaagcgatt      1320
     acaccagacg gtgtctctgt tcaactgttt gtgaacacgg gcctcatgat cgatgtagtc      1380
     cgcggtgtac aacgtggcgc tcaaggtgtg ggtttgtacc gtagtgaaat tccattcatg      1440
     ttacgggaac gtttcccagg tgaagaagaa caacgtgcca tctatcgcca acagttgagt      1500
     cactttgcca ataagccggt agtcatgcgt accctcgata ttggtgccga taaagactta      1560
     ccttacttca gtattgaaga agagaactcg gcattagggt ggcgcggtat tcgtttcacg      1620
     ctcgaccatc cggagatttt ctcagcacaa atccgggcaa tgcttaaagc cagtattggt      1680
     ttaaataatt tgcatatcct attgccaatg gtaacgacag taagtgaagt cgaagaagta      1740
     ctttatttac ttgagcgtga ctggattgca gtacaagaag aagaacaagt taaaattact      1800
     aaaccaaaaa tcgggattat ggttgaggta ccgagtgtac tgctacaaat tgatgagttc      1860
     gcagaacttg tcgatttctt ctcggttggt tcaaatgact taactcaata cttacttgct      1920
     gtggaccgta ataatccgca tgtcgcaaac gtctattcac acttccatcc gtctattttg      1980
     cgggctttaa ctcgactcgt gaaggaatgt cataaatacc aaaaaccagt aagtatttgt      2040
     ggtgagatgg cgggtgatcc gttatcagca atcttactga tggccatggg ctttaatacc      2100
     ctttcgatga gttcaagtaa catcttgcgt gtccgaaaag caatttgcca tgtcccaatg      2160
     tcagatgctc aaaagctgct tgatgatgtc atgaaaatga ataatccgct tattgtaaaa      2220
     agctggcttg agtactactt taaaactcat ggcctagccg atatggttaa atctaaccgc      2280
     cttgtaagcg tataa                                                       2295
//

If you have problems or comments...

PBIL Back to PBIL home page