(data stored in ACNUC29543 zone)

EMBL: CP000521.PE395

CP000521.PE395       Location/Qualifiers
FT   CDS_pept        454027..455445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0417"
FT                   /product="3-isopropylmalate dehydratase (isomerase) subunit
FT                   with LeuD"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10872"
FT                   /db_xref="GOA:A3M1S8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1S8"
FT                   /protein_id="ABO10872.2"
FT                   /translation="MAGKTLYDKLWDDHVVTQRDDGSCLLYIDRHLLHEVTSPQAFEGL
FT                   QLAGRQPWRLSANVATPDHNVPTSKKERDQGIAGIEDDTSRIQVQTLDDNCKAFNIVEF
FT                   GINDIRQGIVHVVGPEQGLTLPGMTVVCGDSHTATHGAFGCLAHGIGTSEVEHVLATQC
FT                   LVQKKSKNMLVRVDGVLGKGVTPKDVVLAIIGKIGTAGGTGYAIEFGGQVFRDMSIEGR
FT                   MTVCNMAIEAGARVGMVAVDEKTIEYVKGRSYAPKGEQWDQAVAYWNTLHSDDDAVFDA
FT                   VVELNGTEIEPQVSWGTSPEMVIPVSKAVPTLEQAKDDVQRNDWTRAYQYMGLNAGQAL
FT                   ADIQLDRVFIGSCTNSRIEDIRAAAEVVKGRKVAPSIKQAMIVPGSGLVKQQAEKEGLD
FT                   KIFLEAGFEWREPGCSMCLAMNADKLQPGEHCASTSNRNFEGRQGNGGRTHLVSPAMAA
FT                   AAAIAGHFVDVRSF"
     atggcaggca aaactttata tgacaaattg tgggatgacc acgtagttac tcagcgtgat        60
     gatggttcgt gcttacttta tatcgaccgt catttattgc atgaagtaac gagtccacaa       120
     gcatttgaag gtttgcaact tgctggtcgt caaccatggc gtttaagtgc aaacgtagct       180
     accccagacc acaacgttcc aacctctaaa aaagaacgtg atcagggcat cgctggtatt       240
     gaagatgata catctcgtat tcaggttcag accttagatg ataactgtaa ggcatttaat       300
     attgttgaat tcggtattaa tgatattcgc caaggtattg tgcatgttgt tggtcctgaa       360
     caaggcttaa ctttaccggg tatgactgtg gtgtgtggtg actcacatac agcgactcac       420
     ggtgctttcg gttgcttggc acatggtatt gggacatctg aagttgaaca tgtgttagca       480
     acacaatgtt tggttcagaa aaaatctaaa aatatgttgg ttcgcgtcga tggcgtattg       540
     ggtaaaggtg taacaccaaa agatgtagtg ttagccatta tcggtaaaat tggtaccgct       600
     ggcggtacgg gctatgcaat cgaatttggt ggtcaggtat tccgtgatat gtcgattgaa       660
     ggacgtatga cggtatgtaa catggcgatt gaagcgggtg cgcgtgtagg tatggttgct       720
     gttgatgaaa aaaccattga atacgtaaaa ggccgtagct atgcaccaaa aggcgaacaa       780
     tgggatcaag cagttgctta ctggaacaca ttgcattcag acgatgatgc tgtgtttgat       840
     gcagttgttg aattaaatgg tacagagatt gaaccacaag tgtcttgggg tacttcacct       900
     gagatggtaa ttcctgtctc gaaagctgta ccaactttag aacaagcgaa agatgacgta       960
     caacgcaatg actggacacg tgcttatcag tatatgggct taaatgcagg tcaggcatta      1020
     gctgatattc aacttgatcg tgtctttatc ggttcttgta cgaattcacg tattgaagat      1080
     attcgtgctg ctgctgaagt agttaaaggt cgtaaagtgg cacctagtat taagcaagcc      1140
     atgattgttc cgggttctgg tttagttaaa caacaggcag aaaaagaagg tttggataaa      1200
     attttcttgg aagctggctt tgaatggcgt gagccgggtt gctcaatgtg cttggcaatg      1260
     aatgcagaca agttacaacc gggtgagcat tgtgcatcaa cctcgaatcg taactttgaa      1320
     ggtcgtcagg gtaatggtgg tcgtactcac ttggtcagtc cggcaatggc agcagcggct      1380
     gcgatcgcag gtcattttgt tgacgttcgt tcattttaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page