(data stored in ACNUC29543 zone)

EMBL: CP000521.PE399

CP000521.PE399       Location/Qualifiers
FT   CDS_pept        complement(458975..459196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0421"
FT                   /product="protein chain initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10876"
FT                   /db_xref="GOA:A3M1T2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1T2"
FT                   /protein_id="ABO10876.1"
FT                   /translation="MANKEELIEFEGVVTETLPNTMFRVRLENGHEVIAHISGKMRKHY
FT                   IRILTGDSVKVEMTPYDLTKGRITYRAR"
     atggccaata aagaggaact cattgagttc gaaggcgttg tcaccgaaac gcttcctaat        60
     acgatgttcc gtgtacgtct tgaaaacggt cacgaagtta ttgcacacat ttctggtaaa       120
     atgcgtaaac actatattcg tattcttact ggcgacagtg tgaaagtcga aatgactcca       180
     tatgacttaa ccaaaggtcg tattacgtac cgtgctcgct aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page