(data stored in ACNUC29543 zone)

EMBL: CP000521.PE406

CP000521.PE406       Location/Qualifiers
FT   CDS_pept        466473..467594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0428"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10883"
FT                   /protein_id="ABO10883.2"
FT                   /translation="MIYIEVLAVVVIWLSFWSLIPRDEWWFRGADFPRLQILFIGLIAL
FT                   IGMLFWPTEWDVWRELLLAVLIAAIAYQLKMVLPYTLFWKKQVKKVKQHQLDPTKQISL
FT                   IVSNVLTPNDKYHLLLEHVRTLKPDLLLTLESDTTWENALKEIEKDYPYRVPVPLDNLY
FT                   GMHLYSRLPLKNTEVKFILSNEIPSIHTTVILRSGMPVQLYCLHPKPPSPTEAKDSTLR
FT                   DAELLIVGDQIKDLDESCIVMGDLNDVAWSRTTRLFQRISGLLDPRVGRHFINTFHADY
FT                   PLLRWSLDHIFHSTDFGLVKMQRLSHIGSDHFPVYVVLQTGRIFEEIHEELEQTQADEE
FT                   EAQAAIQEGIAKAEKEEKIVTDEIAQPYKEKNI"
     atgatttata tcgaagtact ggcagtagtg gtgatttggt taagcttctg gtcacttatt        60
     cctcgtgatg agtggtggtt tcgaggtgca gattttccaa gattacaaat tctgtttatt       120
     ggcttaattg ctttaattgg tatgttgttt tggccgaccg aatgggatgt atggcgtgag       180
     cttttgcttg cggtactcat cgcagcgatt gcctaccaac ttaaaatggt tttaccgtat       240
     acgctgtttt ggaaaaaaca ggttaaaaag gtcaaacagc atcagctaga tcctacaaaa       300
     cagatttcac tgatagtttc taatgtgctc accccgaatg ataaatatca tttattactt       360
     gagcatgtac ggacgttgaa acctgattta ttgcttactt tagagagcga tacaacttgg       420
     gaaaatgctt taaaagagat cgagaaagat tatccatacc gtgtgcccgt acctttagat       480
     aatttatacg ggatgcattt atatagccgg ttaccgctta aaaataccga ggttaaattc       540
     attttaagta atgaaatacc ttctattcat accacagtaa ttttgcgatc tggcatgcct       600
     gttcagctct actgtttaca tcctaagcca cctagcccaa ctgaagcaaa agattcaaca       660
     ctgcgtgacg ctgagctttt aattgtcgga gatcaaatta aagatcttga tgaaagttgt       720
     attgtgatgg gggatttaaa cgatgtagcg tggtcacgaa caacccgttt atttcaacgt       780
     attagtgggc tactcgatcc acgagtgggg cggcatttta ttaatacttt tcatgcggac       840
     tatcctttat tgcgctggtc acttgaccat atctttcata gtacagactt cggtttagta       900
     aaaatgcagc gtttatctca tattggatca gaccattttc ctgtctatgt cgttttacaa       960
     acaggtcgaa tatttgaaga aattcacgag gaactagaac aaactcaagc cgatgaagaa      1020
     gaagctcaag ccgcgataca agaaggtatt gctaaagctg aaaaagaaga aaaaatcgtg      1080
     actgatgaaa ttgcacagcc ttataaagag aaaaatatat aa                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page