(data stored in ACNUC29543 zone)

EMBL: CP000521.PE407

CP000521.PE407       Location/Qualifiers
FT   CDS_pept        468284..469570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0429"
FT                   /product="glutamate:aspartate symport protein (DAACS
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10884"
FT                   /protein_id="ABO10884.2"
FT                   /translation="MKNFKFSLAWQILIALILGIVVGAVLHNQPEIKDSIVNNVLTPLG
FT                   KIFISLIKMIVIPIVFSTLILGIAGVGSTKSLGRLGFKTILYFEIITTIAILVGLFAAN
FT                   IFHPGSGIDMSQLVQTDISQYKHTTEEVQSQSHGIIQTILSLIPTNIISSMAHGEMLPV
FT                   IFFAVLFGIGLSSLPATTKDPLLNVFHAVSETMFRVTHIIMKYAPVGVFGLIAVTVANF
FT                   GFASLIPLGKLVVLVYGAILFFALVVLGITAKMFSINIFTLFKILKDELILAYSTASSE
FT                   TVLPRIMQKMEAYGAPKAISSFVIPTGYSFNLDGSTLYQSIAAIFIAQLYGIEMSISQQ
FT                   VILVVTLMITSKGIAGVPGVSFVVLLATLGSVGIPVEGLAFIAGVDRIMDMARTALNVV
FT                   GNALAVLVISKWEKQYDYEKAAAYEASLK"
     atgaagaatt ttaaatttag ccttgcatgg caaattttaa ttgctttaat cctagggata        60
     gttgtcgggg ctgttttaca taaccagcct gaaatcaaag atagtattgt aaataacgtt       120
     cttactccat taggtaagat ctttattagc ctgattaaaa tgattgtaat cccaatcgtt       180
     ttctctacat tgattttagg tattgctggt gttggcagta caaaaagtct agggcgtctt       240
     ggttttaaaa ccattctcta tttcgaaatt attactacta ttgctatttt ggttggcttg       300
     tttgcagcga atatcttcca tccaggttca ggcattgata tgtctcaact ggtacaaact       360
     gatatttctc aatataagca tacaactgaa gaagtacagt cacagtctca tggtattatc       420
     cagacgatat tatcgcttat cccaacgaac attattagtt caatggcgca tggcgaaatg       480
     ttgccagtga ttttctttgc tgtgctattt ggtattggtt tatcttcatt accagcaaca       540
     acaaaagacc cattattaaa tgtatttcat gctgtatcgg aaacaatgtt ccgtgtaaca       600
     cacatcatca tgaaatatgc gccagtgggt gtatttggct taatcgctgt aactgttgca       660
     aacttcggtt ttgcttcgct tattccattg ggtaaattgg ttgtattggt ttatggtgca       720
     atcttattct ttgctttagt ggttttaggt attactgcaa aaatgttcag catcaatatc       780
     tttactttgt ttaagatttt gaaagacgaa ttaattttgg cgtattcgac tgcaagttcg       840
     gaaacagttt taccgcgtat tatgcaaaaa atggaagctt atggtgcgcc aaaagcgatt       900
     tctagtttcg taattccaac tggttattca tttaaccttg acggttctac gctttaccaa       960
     agtatcgcag caatctttat tgcacagctt tacggcattg aaatgtcaat cagccaacaa      1020
     gtgattttag ttgtaacgtt aatgattact tctaaaggta ttgcaggtgt tcctggggta      1080
     tcatttgttg tgttattggc gacattaggc agtgttggta ttcctgtaga aggcttagca      1140
     tttattgccg gtgttgaccg tatcatggat atggctcgta ctgcgttgaa cgttgtaggt      1200
     aacgcgcttg ctgtacttgt aatcagtaag tgggaaaaac agtacgacta tgaaaaagct      1260
     gctgcttatg aagcatctct taagtaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page