(data stored in ACNUC29543 zone)

EMBL: CP000521.PE410

CP000521.PE410       Location/Qualifiers
FT   CDS_pept        complement(472054..472686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0432"
FT                   /product="putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10887"
FT                   /protein_id="ABO10887.2"
FT                   /translation="MLDLSQILAFGLICLAMVLTPGPNMIYLISRSISQGKIAGFISLG
FT                   GVAVGFVFYMLCASFGITALVVAVPYAYDTIRIAGAMYLLWLAWKALRPNAAPIFNIKD
FT                   LAVDSPLKLFLMGFLTNLLNPKIAIMYLSLLPQFIHPQQGSILAQSIQLGTIQIFVSVS
FT                   VNALIVFSAGSIALFLQKKPLWASIQRWVMGTVLAGLAVRILLEHRR"
     atgctagatc tctctcaaat tttggcattt ggattaattt gtctggcaat ggtactcacc        60
     cctggcccaa acatgattta tcttatctct cgttccatta gtcagggcaa aatcgcagga       120
     tttatttctc tcggtggcgt tgccgttggt tttgtatttt acatgctctg cgcttctttc       180
     gggattacgg cacttgtggt cgcagttcca tatgcctatg acactattcg tattgccggt       240
     gcaatgtact tactctggtt agcgtggaaa gctttacgcc ccaatgccgc acctattttt       300
     aatattaaag atttagcggt tgactcacca ttaaagttat ttttaatggg ctttttgact       360
     aatttactta atcctaaaat tgcgattatg tatttatctt tattacctca gtttattcac       420
     ccacaacaag gcagtatttt agcgcagtct atccaactcg ggactataca aatttttgta       480
     agcgtttcag taaatgcgct gattgtattt tctgctggta gtattgctct ttttctacaa       540
     aaaaaaccac tttgggcaag cattcaacgc tgggtcatgg gtacagtatt agccggtctt       600
     gcggttcgta ttcttctaga acaccgccga taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page