(data stored in ACNUC29543 zone)

EMBL: CP000521.PE411

CP000521.PE411       Location/Qualifiers
FT   CDS_pept        complement(472832..474742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0433"
FT                   /product="transport protein Uup"
FT                   /note="ABC superfamily atp_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10888"
FT                   /protein_id="ABO10888.2"
FT                   /translation="MAYITLRDVQLAFGGPALLDGANFNLERGERVCLIGRNGEGKSTL
FT                   LKLIEGSLLPDSGEVSVQNGLTVSMLAQDVPMSSGKVADIVAEGAGEAAAVLKAYHEAS
FT                   DACVLGDMEACDRMGSLQHKLDQLDGWALENKVNTILGKMELDPNADLADLSGGRKRRV
FT                   LLARALLTQPDVLLLDEPTNHLDVESIEWLEKFLLDQNNLTLLFISHDRSFVDRLATRI
FT                   VELDRGILRSYEGNYSRYLDLKAQQLEAEEKQNALFEKKLAEEEAWIRQGIKARRTRNE
FT                   GRVRALKALREESKARRFQQGKVNMGVQEAQRSGKLVFDIEHLSVSYDRQTLIRDFSAI
FT                   VMRGDRIGLVGDNGVGKTTLIKAILGEVQHEGVVKTGTQLEIAYFDQLRNQLDLEKSVS
FT                   ENVSEGSDFVDVNGQRRHILSYLQDFLFSPERARTPVKALSGGERNRVLLAKLLLKPSN
FT                   LIVMDEPTNDLDMVTLELLEEMLSEYKGTLLLISHDRAFMDNVVTSTWVFDGKGGIAEY
FT                   IGGYQDYLIQRPNERVVDQKGDVKKAQAKAEAEKNAAQTNVKKVKLSYKDQRELEQLPA
FT                   EIEKLENEQAELSDKLADGSWFVTDADAATKASQRLAEIEELLLEKLERWDELEQMSKG
FT                   N"
     atggcctata ttactttaag ggatgtccaa cttgcttttg gcggacctgc cctgctcgat        60
     ggcgcgaact tcaacctaga acgtggcgaa cgagtctgtt taattggtcg taatggtgaa       120
     ggtaagtcta ctttacttaa actcattgag ggaagcctac taccagattc tggtgaagtt       180
     tctgtccaaa atggtttaac tgtttctatg ttagcccaag atgttccaat gtcatcgggc       240
     aaagttgcag atattgtagc agaaggtgca ggcgaagccg ctgccgtact taaagcctat       300
     catgaagcaa gtgatgcctg tgtacttggt gacatggaag cttgcgatcg tatgggatct       360
     ttacagcata aacttgacca acttgatgga tgggcattag aaaataaggt caacacgatt       420
     ttaggtaaaa tggagttaga tccgaatgca gatctagccg acctatcggg tggtcgtaaa       480
     cgtcgtgttt tacttgcccg cgccctactt acccaaccag atgtgttatt actcgatgag       540
     ccaactaacc acttagatgt tgaaagtatt gagtggcttg agaaattcct gcttgatcaa       600
     aataatttaa ccttactctt tatttcgcat gaccgttctt ttgtagaccg ccttgcaact       660
     cgtattgtgg aattggatcg cggcatatta cgcagctatg aaggaaacta ttctcgttac       720
     cttgacctaa aagctcagca acttgaagct gaagaaaaac aaaatgcctt gtttgaaaag       780
     aaacttgccg aagaagaagc atggattcgt caaggtatta aagcacgtcg tacacgtaat       840
     gaaggtcgtg tccgtgccct taaagcatta cgagaagagt caaaagctcg ccgtttccaa       900
     caaggcaaag tcaatatggg cgttcaagaa gcacagcgct ccggcaaact tgtatttgat       960
     attgaacatt taagcgtaag ttacgataga caaaccctca ttagagattt ctctgccatt      1020
     gttatgcgcg gtgaccgcat tggtttggtc ggtgataacg gcgtaggaaa gactacttta      1080
     attaaagcga tcttaggcga agttcagcac gaaggtgttg tcaaaacagg aactcagctt      1140
     gaaattgctt acttcgacca attacgtaat cagcttgatc ttgaaaagtc ggtttctgaa      1200
     aacgtttctg aaggttcaga tttcgttgat gtaaatggtc aacgtcgcca tattcttagt      1260
     tacttacaag acttcctatt ctctccggaa cgagctcgta caccggtaaa agcactttct      1320
     ggtggtgagc gtaatcgtgt cctgttagca aaactattgc tcaagccatc gaacctgatt      1380
     gtaatggatg agccaacgaa tgacttagat atggtcacac ttgagctact tgaggagatg      1440
     ttgtctgaat ataaaggtac tttgcttcta attagccatg accgtgcttt tatggacaac      1500
     gttgtaacat caacttgggt atttgatggc aaaggcggta ttgcagaata tatcggtggt      1560
     tatcaggact atttaattca gcgtccaaat gagagagtcg ttgaccaaaa aggcgatgta      1620
     aaaaaagctc aggctaaagc agaagctgaa aaaaatgcag ctcaaacgaa cgtaaaaaag      1680
     gtcaaattaa gctacaaaga tcaacgtgaa cttgagcaat taccggcaga aattgaaaag      1740
     ttagaaaatg agcaagctga actttctgac aaacttgctg acggctcatg gttcgtaacg      1800
     gatgccgatg cggcaaccaa agcaagccag cgtctagcag aaattgaaga gttactcctt      1860
     gaaaagttag agcgttggga tgaacttgag caaatgagta aagggaatta a               1911
//

If you have problems or comments...

PBIL Back to PBIL home page