(data stored in ACNUC29543 zone)

EMBL: CP000521.PE412

CP000521.PE412       Location/Qualifiers
FT   CDS_pept        474775..475020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10889"
FT                   /protein_id="ABO10889.1"
FT                   /translation="MTKPPYHDDQASFSAPIEDLQVRIAFLDDLVEELNQQLAIQTLEI
FT                   ADLKKQMQLLYQRVESADLSEGVAPFDPLTNKPPHY"
     atgactaaac caccatatca tgatgatcaa gcgtcatttt ccgcacccat tgaagatttg        60
     caagtgcgaa ttgcattttt agatgattta gttgaggaat taaatcagca actcgcgatt       120
     caaactttag aaatagctga tttaaaaaaa caaatgcaat tactttatca acgtgtggaa       180
     tctgcagatt tatcagaagg tgttgcacct tttgatccat taacgaataa gccaccgcat       240
     tattaa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page