(data stored in ACNUC29543 zone)

EMBL: CP000521.PE413

CP000521.PE413       Location/Qualifiers
FT   CDS_pept        complement(474779..475009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10890"
FT                   /protein_id="ABO10890.1"
FT                   /translation="MAYSLMDQKVQHLLINLQIPHVDKVIAFVFLNQLFLKFESRVADL
FT                   IPQLNHLKMQFALANLQWVRKMTLDHHDMVV"
     gtggcttatt cgttaatgga tcaaaaggtg caacaccttc tgataaatct gcagattcca        60
     cacgttgata aagtaattgc atttgttttt ttaaatcagc tatttctaaa gtttgaatcg       120
     cgagttgctg atttaattcc tcaactaaat catctaaaaa tgcaattcgc acttgcaaat       180
     cttcaatggg tgcggaaaat gacgcttgat catcatgata tggtggttta g                231
//

If you have problems or comments...

PBIL Back to PBIL home page