(data stored in ACNUC29543 zone)

EMBL: CP000521.PE415

CP000521.PE415       Location/Qualifiers
FT   CDS_pept        476178..476555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10892"
FT                   /protein_id="ABO10892.2"
FT                   /translation="MAKARHSSFDCSPGCSVEAAISLIDGKWKCVILWHLLNEGTLRFN
FT                   EIRKRVPSITQRMLTNQLRELEQDGIIHREVYPQVPPKVEYCLTDLGRGLEQILLALKT
FT                   WGDAHLDQFGKLTTLETEKSA"
     atggcaaaag ctcgacattc aagttttgac tgctcaccag gttgttcagt tgaggcagcg        60
     atcagtttga ttgatggcaa atggaaatgt gtcattcttt ggcatttatt aaatgaagga       120
     actttacgat ttaatgaaat tcgtaaacga gttccaagca ttacacaaag aatgctgacc       180
     aatcagcttc gggaattaga acaagatggc attattcatc gtgaggttta tcctcaagtg       240
     cctcctaaag tggaatattg tctaactgat ttagggcgcg ggcttgagca gatacttctt       300
     gctttaaaaa cttggggaga tgcgcatctg gatcagtttg gtaagttaac tactcttgaa       360
     actgaaaaga gcgcctaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page