(data stored in ACNUC29543 zone)

EMBL: CP000521.PE418

CP000521.PE418       Location/Qualifiers
FT   CDS_pept        479912..480670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10895"
FT                   /protein_id="ABO10895.2"
FT                   /translation="MWKNIRILCLLIVLLIVAVQAWRDQNQDWNQPIVVVLHPINADGL
FT                   QTTQTYIHQLQNTDFQALKSYLSEWSQHYRGQSANFKIRLGQQLQQRPPEVPQNAGIFH
FT                   VVWWSLKFRFYAWRQQQPEDNGASLKLYLNYYDPNYQKVLVHSTALEKGRIGSVNLFAT
FT                   RGQALQNQVVIVHELLHGFGAKDKYDLKTGQPIYPLGYAQPEKVPLYPQKRAEIMGGRT
FT                   PLSEQTSKMPSDLQETVIGLPTAQEVGWLK"
     atgtggaaaa acattcggat tttatgtcta ttaattgttt tattaatcgt tgcagttcaa        60
     gcgtggcgtg accaaaacca agactggaat cagcctattg tggtggtatt acacccaata       120
     aatgcagatg gcttacaaac cacacaaact tatattcatc agttacaaaa cactgatttc       180
     caggcgctta aaagctattt aagtgaatgg tcgcaacatt atcggggcca atcagcaaac       240
     tttaaaatac gtttggggca acagttacag cagcgtccac ctgaggtgcc acaaaatgct       300
     ggtatttttc atgtggtttg gtggagttta aagtttcgtt tttatgcctg gcgacaacaa       360
     cagcctgaag ataatggagc atcgctcaaa ctttatttaa attattacga tcccaattat       420
     caaaaagttt tggtgcattc gactgcttta gaaaagggcc gtattggtag tgttaatttg       480
     tttgctacac gtgggcaagc actacaaaat caggttgtaa tcgttcatga gctattgcat       540
     ggctttgggg caaaagataa atatgattta aaaacaggtc agcctatata tccattagga       600
     tatgcacaac ctgaaaaagt acctctttat ccacaaaagc gagcagaaat catgggtggt       660
     cgaacaccat tatctgagca gaccagcaaa atgccaagtg atttacaaga aaccgtcata       720
     ggtttaccaa cagcccaaga agtggggtgg ctgaaataa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page