(data stored in ACNUC29543 zone)

EMBL: CP000521.PE419

CP000521.PE419       Location/Qualifiers
FT   CDS_pept        480808..481380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0441"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10896"
FT                   /protein_id="ABO10896.2"
FT                   /translation="MKTVGNDLVRNQLHADRKWYLILGFVLIIFGLVLFSSLPFATFSV
FT                   VFLFGILMMVGGVLHLIAALSVFKSGSRWLWALFGVLYLMAGYYAFSTPVTTAVVLTSL
FT                   LSIALIIAGVIRTINAFLLRPIAGWGWTLFSGLLTLATGILILVSKNSPFWVLGMFLAV
FT                   DILFQGINFLGLASAIKHLPSSSKTVS"
     atgaaaactg taggtaatga tttggttcgt aatcagctac atgctgatcg taaatggtat        60
     ctaatattag gctttgtgct cattattttc ggtttggtgt tatttagctc actgccattt       120
     gccacatttt cggttgtttt tctgtttggt attttaatga tggtgggcgg tgtactgcat       180
     ttaattgctg ccttaagtgt atttaaaagc ggtagccgat ggctgtgggc actttttgga       240
     gtgctgtatt taatggcagg ctattatgca ttttctacgc ctgttactac ggctgtggtt       300
     ttaacaagct tattatcaat tgctctgatt attgcgggtg taatccgcac tataaatgca       360
     tttttactaa gaccaattgc agggtggggc tggaccttat tttcaggatt attaaccctc       420
     gctacaggta ttttaatttt agtttctaaa aattctccct tttgggtgtt gggaatgttt       480
     ttagcagtag atattttatt tcagggcatt aactttttag ggctcgcttc tgcgattaag       540
     catttacctt ctagttcaaa aacggtttct taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page