(data stored in ACNUC29543 zone)

EMBL: CP000521.PE423

CP000521.PE423       Location/Qualifiers
FT   CDS_pept        484051..484584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10899"
FT                   /protein_id="ABO10899.2"
FT                   /translation="MAILEQESLVMSRVARYHADRTNQKLYFARLACQQAEQTDHVQQV
FT                   QAYREAAVFHLHGAMLAFLQELVRYYRLNDLQPTLKSIEEHMAAKGQVSPEVSVLQQLA
FT                   KDGFVAELKRAYRMCQYAPEPTEPTPEEETSSNLIIKVTQGPQSWLPDVKILREWHREL
FT                   SHLIDGFRNEMVEF"
     atggcaattt tagaacagga aagtttagtt atgtcacgtg ttgctcgtta tcatgccgat        60
     cgtaccaatc aaaaactcta ttttgcacgc ttagcgtgtc aacaagcaga gcaaactgat       120
     catgtacagc aggtacaagc gtatcgtgaa gcagctgtat ttcatttaca tggtgcgatg       180
     ttggcatttt tgcaagaatt ggtacgttat taccgtttaa atgacttgca accgacatta       240
     aaatctattg aagagcatat ggcggcaaaa ggacaagttt ctccggaagt ttctgttttg       300
     cagcaattgg caaaagatgg cttcgttgca gaattaaaac gtgcttaccg tatgtgccaa       360
     tatgcaccgg aaccaactga accgacaccg gaagaagaaa cttcttctaa tttgatcatt       420
     aaagtgactc agggaccaca atcatggtta cctgatgtga aaattttgcg tgaatggcat       480
     agagagttaa gtcatttaat tgatggtttt cgtaacgaaa tggtcgagtt ctaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page