(data stored in ACNUC29543 zone)

EMBL: CP000521.PE427

CP000521.PE427       Location/Qualifiers
FT   CDS_pept        complement(487037..487273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0448"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10903"
FT                   /db_xref="GOA:A3M1V9"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1V9"
FT                   /protein_id="ABO10903.1"
FT                   /translation="MSKVCQVTGKRPVVGNNVSHANNKTKRRFEPNLHHHRFWLESEKR
FT                   FVRLRLTTKGMRIIDKLGIEKVVADLRAQGQKI"
     atgtctaagg tttgccaagt taccggcaag cgtccagtcg ttggtaacaa cgtctcacac        60
     gccaacaaca aaaccaagcg ccggttcgag ccgaacctgc accaccaccg tttctggtta       120
     gaaagcgaaa aacgttttgt acgtcttcgt ttaaccacta aaggtatgcg tattattgac       180
     aaattgggta tcgaaaaggt tgttgcagac cttcgtgctc aaggtcaaaa gatctaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page