(data stored in ACNUC29543 zone)

EMBL: CP000521.PE43

CP000521.PE43        Location/Qualifiers
FT   CDS_pept        complement(49196..49333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3479"
FT                   /old_locus_tag="AS1_3479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3479"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89904"
FT                   /protein_id="ABS89904.1"
FT                   /translation="MQLLVGGVVGDELSELLSSLQALSMSAKDVINKIESFRIGFFQTV
FT                   "
     ttgcaattac tggtaggcgg tgttgttggc gatgaattat ctgagttgtt gtcatcgtta        60
     caagcactga gcatgagtgc taaagatgta attaataaaa ttgaaagttt tcgcattggt       120
     tttttccaaa cggtttaa                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page