(data stored in ACNUC29543 zone)

EMBL: CP000521.PE432

CP000521.PE432       Location/Qualifiers
FT   CDS_pept        491824..492444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0453"
FT                   /product="putative biopolymer transport protein (ExbB)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10908"
FT                   /protein_id="ABO10908.2"
FT                   /translation="MNFSIYWQHADAVSKTLYFILLAMSIATWTVFILRLMGTRQLKQQ
FT                   AYAQLSQAITSLKAKLQPLSFEQRKAVAEQALLRQISAEKANADKGISVLGTIASIAPF
FT                   VGLFGTVWGIFHALVAVGKSGQAGLAQVATPVGEALIMTGLGLAVAIPAVLAYNICVRA
FT                   NRGLAHDLQDQAHSLLIDTMLQQDSTVKSDVKTAQQSYVGGQA"
     atgaactttt caatctattg gcaacatgca gatgcagtga gtaaaaccct gtatttcatc        60
     ttattggcaa tgtcgattgc tacctggaca gttttcatct tacgtttgat ggggactcgc       120
     caactaaaac aacaagctta tgctcaactc tctcaggcta ttacttcgct caaagcaaag       180
     ttacaacctt tgagttttga acaacgtaaa gcagttgcag agcaagcatt attgcgtcag       240
     atttctgctg agaaagccaa tgctgataaa ggtatttcag ttttaggaac aattgcttca       300
     attgcaccat tcgttggttt gtttggtaca gtatggggta ttttccacgc gttagttgct       360
     gttggtaaga gcggacaggc aggtttagct caagtggcta caccggtagg tgaagcactt       420
     attatgactg gtcttggtct agcagttgcg attccagcgg tattggctta taacatctgt       480
     gtacgtgcga atcgtggcct tgctcatgat ttacaagatc aagcacacag tttgttaatc       540
     gacaccatgt tgcagcaaga ctcaactgta aagtctgatg ttaaaactgc acagcaaagt       600
     tatgttggag gtcaagctta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page