(data stored in ACNUC29543 zone)

EMBL: CP000521.PE433

CP000521.PE433       Location/Qualifiers
FT   CDS_pept        492444..492848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0454"
FT                   /product="putative biopolymer transport protein (ExbD)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10909"
FT                   /protein_id="ABO10909.2"
FT                   /translation="MAFQLGEDHDSGMNEMNLIPLIDIMLVLMIIFLVTATVANPSIPL
FT                   TLPKTTAEIIDPPPKAITISINANGEVAWDTQVISLDELQKRFQEAGQGAVKPTVQLRA
FT                   DKESKYDTVAQVMSRASEAGLSDIAFVSEN"
     atggcttttc aattgggtga agaccacgat agtggcatga atgagatgaa tctcattccg        60
     ctaatcgaca ttatgttggt gttaatgatc atctttttgg tcacagcaac agttgccaac       120
     ccatcgattc cattaacgct tcctaaaaca actgctgaaa ttattgatcc accaccaaaa       180
     gcaattacga ttagtatcaa tgcaaatggt gaagtggctt gggatactca agtaattagc       240
     cttgatgagc ttcaaaaacg cttccaagaa gcaggtcaag gtgcggttaa accgacagtt       300
     caacttcgcg ctgataaaga gtcgaagtac gatactgttg ctcaggtaat gtctcgcgcc       360
     agtgaagccg gactgagcga tattgccttt gtaagtgaaa actaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page