(data stored in ACNUC29543 zone)

EMBL: CP000521.PE435

CP000521.PE435       Location/Qualifiers
FT   CDS_pept        complement(493531..494586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0456"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10911"
FT                   /protein_id="ABO10911.2"
FT                   /translation="MHNIGTREFIIALLFGALHSLFTLFIVLSSIWVCLALWVQQPFGW
FT                   LGSRIIIGIWIAFALSMAGLYFNGHIISRRTDVLIYLLAFACSLVWYFSITARQDRDWN
FT                   PEVANMLSYEKHGDVITLHNVRNFNWHPDGTYDVRWETRTFDLNQLNGINIITSYWMGP
FT                   QIAHTLVSFEFKNQQPLVFSIEIRKEKTEEFSAIGGFFRKYELSLIASDEKDIVYTRSN
FT                   IRKEQVYNFPVNMPRSEQKALFLEYLKKADELRAEPKWYNTLTSNCTTLIFDMVQAINP
FT                   YQLPKDYRLIASGYLPNYLYDLKALDQNISLKQWYQIAHINPRTEHFEQFADQSSEHFS
FT                   QIVRQGLPKVK"
     atgcacaata tcggaacacg tgaatttatt atcgccctcc tcttcggcgc tttacatagt        60
     ttattcacgt tgtttattgt gctttccagc atttgggtat gcttagccct atgggtccaa       120
     caaccttttg gctggttagg cagccgtatt attattggca tatggattgc ctttgcttta       180
     agtatggcgg gtttatattt taatgggcat attattagcc gtcgtacaga cgttttaatc       240
     tacctattag cttttgcctg ctctttagtt tggtactttt cgattactgc acgtcaagac       300
     cgtgactgga accctgaagt tgccaatatg ctaagttacg aaaaacacgg cgatgttatt       360
     actttgcata atgtccgtaa cttcaactgg catcctgatg gaacctatga tgtccgctgg       420
     gaaacccgta cttttgacct gaaccagtta aatggcataa atatcattac ctcttactgg       480
     atggggccac aaattgccca tacgctagtc agtttcgaat ttaaaaatca acaaccttta       540
     gttttttcga tcgaaattcg aaaagaaaag actgaagagt tttcagcaat tggcggcttc       600
     tttagaaaat atgaactgag cttaattgca tctgatgaaa aagatattgt ctacacgcgt       660
     agcaatatcc gtaaagagca agtttataat ttcccggtca atatgcctcg ctctgagcaa       720
     aaagcgctat ttttagaata tcttaaaaaa gcagatgaac tacgcgcaga accaaagtgg       780
     tacaatacgc tcacaagtaa ttgtacaact ttaatttttg atatggttca agccattaac       840
     ccatatcagc ttcctaaaga ttatcggtta attgcctctg gttacttacc taattattta       900
     tatgatctta aagcactcga tcaaaatatt agcttgaaac agtggtatca aattgcacac       960
     attaacccac gtactgaaca ttttgaacaa tttgcagacc aaagcagtga gcatttctct      1020
     caaattgttc gacagggttt acctaaagta aaatga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page