(data stored in ACNUC29543 zone)

EMBL: CP000521.PE438

CP000521.PE438       Location/Qualifiers
FT   CDS_pept        complement(496493..496852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0459"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10914"
FT                   /protein_id="ABO10914.2"
FT                   /translation="MLEFWFNTQVPTFKKLIILIITLLICIGLYQYQPLPLDTILMFTG
FT                   TGVIFLICRYFKLHFAQSNPTGLLYRLFTWVPIALLFALIFVKTMPNLLIWGVQGIAFM
FT                   ALAAFIFSPQSLFNK"
     atgctggaat tctggtttaa tacgcaagtc ccgactttta aaaaattaat cattttaatt        60
     attaccctct taatctgtat tgggttatat caatatcaac cattgccttt agataccatt       120
     ttaatgttta caggaactgg ggttattttt ttaatctgcc gttactttaa attgcatttt       180
     gctcaaagta acccgactgg tttactttac cgcctattta cgtgggttcc tatcgctctt       240
     ttatttgcac ttatctttgt aaaaaccatg cctaacttgc tgatctgggg cgttcaagga       300
     atcgctttta tggcgcttgc tgcttttatt ttttcacctc aatcgttatt taataaatag       360
//

If you have problems or comments...

PBIL Back to PBIL home page