(data stored in ACNUC29543 zone)

EMBL: CP000521.PE440

CP000521.PE440       Location/Qualifiers
FT   CDS_pept        497837..498616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10916"
FT                   /protein_id="ABO10916.2"
FT                   /translation="MCIVALAWHVLDDMPLCLISNRDEFYHRPTALLHQWEHTPIIAGQ
FT                   DLQSGGTWMGVTPQGRWAVLTNFRDGRDKKQYETSRGHLVQAFLESDLLPIRFAQQLEQ
FT                   QQQNFAGFNLFMGTADQAVYMSNRGEAPQVLANGVYVVSNGLMSDHWEKTRHLRTRFTQ
FT                   EFLPMHQHKTEELSLQHAAWDILEDERKVTTALLPNTGIQPEMEELLSSTFIQSPVYGT
FT                   RCSNFLRMTNNEWIWLEKTQQGEHSGQIVQQQVLLNR"
     atgtgtattg tggctttagc atggcatgtt ctggatgata tgcccttgtg tctgatttca        60
     aatcgtgatg aattttatca tcgaccaacc gcattgttgc atcaatggga acatacgcca       120
     atcattgcag ggcaagactt acagtcgggt ggtacttgga tgggtgttac gccgcagggc       180
     cgatgggctg tgttaactaa tttccgtgat ggacgtgata aaaaacaata tgagacttct       240
     cgtggtcatt tggttcaggc ttttttagag tctgatttgt taccgattcg ctttgctcag       300
     caattagaac aacagcaaca gaactttgct ggttttaacc tgtttatggg aactgctgat       360
     caggcggtct atatgagtaa ccgcggtgag gctcctcaag tattagccaa cggtgtatat       420
     gtggtttcga atggtttaat gtccgaccac tgggaaaaaa ccagacattt acgcacacgt       480
     tttacgcaag agttcttgcc tatgcatcag cacaaaacag aagagttaag tttgcagcat       540
     gcagcgtggg atattttaga agatgagcgt aaggtcacca cagcattgtt gccaaacacg       600
     ggcattcagc cggaaatgga agaattattg tcatcgactt ttattcaaag ccccgtatat       660
     ggaacacggt gttcgaattt tttaagaatg accaataatg aatggatatg gttggaaaag       720
     acccagcagg gtgaacatag tggtcaaatt gtgcagcaac aggtgctttt aaaccgttag       780
//

If you have problems or comments...

PBIL Back to PBIL home page