(data stored in ACNUC29543 zone)

EMBL: CP000521.PE449

CP000521.PE449       Location/Qualifiers
FT   CDS_pept        complement(507686..508279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0470"
FT                   /product="methionine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10925"
FT                   /protein_id="ABO10925.2"
FT                   /translation="MRIDQQLAEKWIKPGSSVLDLGCGDGELLAHMSQKHQIRAYGLEI
FT                   DQEKIAIAVSRGLNIIQQDLNLGLSRFADQSFDYVVMAQALQAVDAPDVLLRDMVRVGK
FT                   QAIITFPNFAHWKTRSFLALKGMMPVSDALPYMWYNTPNIHLCTFKDFEALCAENQIQI
FT                   INRLAVNGNQQGSLLSKHVPNLFGEVAIYRVSAL"
     atgcgtattg atcaacaact ggcagaaaag tggattaaac ccggctctag cgtactcgat        60
     ttagggtgtg gtgacggtga attactcgct catatgagcc aaaagcatca aattcgtgct       120
     tatggtttag aaattgatca agaaaagatt gcaattgccg tcagtcgcgg gttaaatatt       180
     attcaacaag atttgaatct cggtttaagc cgttttgccg accagtcttt tgactatgtg       240
     gttatggcac aggctttgca agccgtagat gcacccgatg ttttattaag agacatggtg       300
     cgtgtgggta aacaggccat tatcactttt ccaaactttg cacactggaa gactcgctct       360
     tttctagcat taaaagggat gatgcctgta tcggatgctc taccatatat gtggtataac       420
     acccccaaca ttcatttatg tacgtttaaa gatttcgaag cactatgtgc ggaaaatcaa       480
     atacaaatta ttaatcgact cgccgtcaat ggaaaccagc agggaagcct gttaagcaaa       540
     catgttccga atttgtttgg tgaagtcgct atttatcgag tgagtgcact atga             594
//

If you have problems or comments...

PBIL Back to PBIL home page