(data stored in ACNUC29543 zone)

EMBL: CP000521.PE45

CP000521.PE45        Location/Qualifiers
FT   CDS_pept        51947..52114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3480"
FT                   /old_locus_tag="AS1_3480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3480"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89905"
FT                   /protein_id="ABS89905.1"
FT                   /translation="MLQGFIVLLAVVTFVLMAADPRDSGAQATQSAWQKTQAADMTKSQ
FT                   KNTNNDADFI"
     atgctacaag gttttattgt attattagca gtagttactt ttgttttaat ggctgccgat        60
     ccacgggata gtggggcaca agcgactcag tcagcatggc aaaaaacaca agcggcagat       120
     atgaccaagt cgcaaaaaaa taccaataat gatgctgatt ttatttag                    168
//

If you have problems or comments...

PBIL Back to PBIL home page