(data stored in ACNUC29543 zone)

EMBL: CP000521.PE456

CP000521.PE456       Location/Qualifiers
FT   CDS_pept        516697..517302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0476"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /note="Endopeptidase Clp; Caseinolytic protease; Protease
FT                   Ti; Heat shock protein F215"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10931"
FT                   /protein_id="ABO10931.2"
FT                   /translation="MYVPTIENALVPVVVEQSSRGERSFDIYSRLLRERVIFLTGEVED
FT                   NMANLIVAQMLFLEAENPDKDIHLYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAA
FT                   SMGAFLLNAGAKGKRYCLENARVMIHQPLGGFRGQASDIEIHAREILFIKERLNRLMAE
FT                   HSGQDYDTIARDTDRDNFMTAQAAKEYGLVDQVLSKRP"
     atgtatgttc caacaattga aaatgcttta gttcctgttg tggttgaaca atcttctcgc        60
     ggcgaacgtt cttttgatat ttattcacga cttttacgtg agcgcgtcat ttttctaact       120
     ggtgaagttg aagacaacat ggcaaatttg attgttgccc aaatgttgtt cttggaagct       180
     gaaaacccag ataaagatat ccatctttat attaactcgc caggtggttc ggtcactgct       240
     ggtatggcga tttatgacac gatgcaattt attaaacctg atgtagtgac atactgtatg       300
     gggcaggctg catctatggg cgcattctta ttaaatgctg gtgctaaagg taaacgctat       360
     tgccttgaaa atgcacgtgt aatgattcac caaccattag gtggattccg tggtcaagca       420
     tcagatattg aaattcatgc tcgtgaaatt ctatttatta aagagcgctt gaaccgtttg       480
     atggcagaac acagtggtca agactatgac acgattgctc gtgataccga tcgtgataac       540
     tttatgactg cacaagcagc aaaagaatat ggcttggtcg atcaggtatt aagtaagcgt       600
     ccataa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page