(data stored in ACNUC29543 zone)

EMBL: CP000521.PE457

CP000521.PE457       Location/Qualifiers
FT   CDS_pept        517404..518717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0477"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10932"
FT                   /db_xref="GOA:A3M1Y8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1Y8"
FT                   /protein_id="ABO10932.2"
FT                   /translation="MSEHPQGQKHCSFCGKTQSEVGKLIAGEDAYICNECVDVCLDLVQ
FT                   TSQQVEAGDWASKALPKPHEIRAALDQYVIGQDLAKKTLSVAVYNHYKRLKVGQSGHVS
FT                   KDVEIAKSNILLIGPTGSGKTLLAQTLARLLDVPFAMADATTLTEAGYVGEDVENIVQK
FT                   LLQKADYDVEKAQKGIIYIDEIDKITRKSENPSITRDVSGEGVQQALLKMIEGTVASIP
FT                   PQGGRKHPQQEFIQIDTSNILFICGGAFAGLEKIVQQRQEKGGIGFTADVKNKDETKKL
FT                   AELFRQVEPTDLVKFGLIPEFIGRLPVIATLEELDEEALMQILTEPKNALTRQYQYLFN
FT                   MENVDLVFEDSALRAVAKRALERNTGARGLRSILENVLLETMYDLPSRTDVGTVFINEA
FT                   VINGEAEPVYKSERQPKEAVTHESVAKADLKVIDSKSA"
     atgtccgaac atcctcaagg acaaaaacat tgttcatttt gcggtaaaac gcagtctgaa        60
     gtcgggaaac tgattgcggg cgaggacgca tatatttgta atgagtgtgt agatgtctgc       120
     ttagaccttg tacaaaccag ccaacaggtt gaagcaggtg actgggcgag caaggcattg       180
     ccaaaaccac atgaaatacg tgctgcgctt gatcaatatg tgattggtca ggatcttgcc       240
     aaaaagacat tatctgttgc tgtttataac cattataagc gtttgaaagt cgggcaatct       300
     ggtcatgtgt ctaaagatgt ggaaattgct aaaagtaaca ttctactgat tgggcctacc       360
     ggttcaggta aaacattact tgctcaaaca ttggctcgtt tgttagatgt gccgtttgca       420
     atggcagatg cgactacttt gacagaagcg ggttatgttg gcgaagacgt tgaaaatatc       480
     gtacaaaaac ttttgcaaaa agcagattac gatgtagaaa aagctcaaaa gggtattatc       540
     tacattgatg aaatcgacaa aattacacgt aaatctgaaa atccgtcgat tactcgtgat       600
     gtgtctggtg aaggtgtaca acaagctttg cttaagatga ttgaaggtac tgtagcctca       660
     attccaccac aaggtggacg taagcatcca cagcaagagt tcattcaaat tgatacctca       720
     aatatcctat ttatttgtgg tggtgcattt gctggactgg aaaaaattgt acaacagcgt       780
     caagagaaag gtggaattgg ctttacggct gatgttaaaa acaaagatga aaccaaaaaa       840
     cttgctgaat tattccgtca agttgagcca actgatttag ttaaatttgg tttaattcca       900
     gaattcattg gccgtttacc agtgattgca acgcttgaag agcttgatga agaagcgtta       960
     atgcaaattt tgactgaacc gaaaaatgca ttaactcgtc agtatcaata cctgttcaat      1020
     atggaaaatg ttgacctcgt atttgaagat tcagctttac gtgcagtggc taagcgtgcg      1080
     cttgagcgta ataccggagc tcgtggccta cgttcgattt tggaaaatgt tctacttgaa      1140
     acgatgtatg acttgccaag ccgtacagat gtaggaacag ttttcattaa tgaagcagtt      1200
     attaatggtg aagctgagcc tgtctacaag tcagaacgtc agcctaaaga agctgtaact      1260
     catgaaagtg ttgctaaggc agatttaaaa gtaattgatt cgaagtctgc ttag            1314
//

If you have problems or comments...

PBIL Back to PBIL home page