(data stored in ACNUC29543 zone)

EMBL: CP000521.PE462

CP000521.PE462       Location/Qualifiers
FT   CDS_pept        complement(524247..525449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0482"
FT                   /product="acetate kinase (propionate kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10937"
FT                   /protein_id="ABO10937.2"
FT                   /translation="MATSVLVINCGSSSIKYALVSERREDRIYGLAENLGAADARIKGI
FT                   TVGGEPLELSIPYADHAKALETLLARLANYKPQAIGHRVVHGGSLTKAELLTPEIVERI
FT                   RAATPLAPLHNPAHLIGIEATMRLFPELPQVAVFDTAFHQTMPAHAYRYAIPKFLYTEH
FT                   NVRRYGFHGTSHAYVSDRGSELAGKFQKGGWLTAHLGNGSSTCAVWNGQSVDTSMGLTP
FT                   LEGVVMGTRSGDVDPSLHSFLAKNLGWDLAKIDKVLNNESGLLGLSQLSNDMRTVIEAA
FT                   ENGNEDACLAIEVFSYRLAKSLAALSCGLPSIDGLIFTGGIGENSAYIREKTLAYLPHF
FT                   GLQLDKDQNNNLKRGTEGRIDSGTGPQIWVIPTDEEGRIAKETRQVVEVSQNTSPEVSL
FT                   A"
     gtggctacat cagtattagt tattaattgc ggttcttcat ctattaaata cgctctggtt        60
     tcagagcgtc gtgaagatcg tatttacggt ttagcagaaa acttaggggc agctgatgct       120
     cgtattaaag ggattaccgt cggtggagaa ccgctagagc tttcaattcc ttatgctgac       180
     cacgccaaag ctttagaaac tttacttgca cgtcttgcaa actataaacc tcaagcaatc       240
     ggtcaccgtg tcgtacatgg tggaagcctt accaaagctg aactactcac ccctgaaatt       300
     gtagaacgta ttcgtgcagc cactccgctt gcaccgcttc ataatcctgc tcacttaatc       360
     gggattgaag caacgatgcg cctattccct gaattacctc aagttgccgt atttgacacc       420
     gcatttcatc aaactatgcc tgcgcatgca taccgttatg caatccctaa gtttttatat       480
     acagaacata atgttcgtcg ctatggtttc cacggtacaa gccatgctta tgtgtctgac       540
     cgcggcagtg aactggcagg aaaattccaa aaaggcggtt ggttaacagc acacttgggc       600
     aatggtagct cgacttgtgc agtgtggaat ggacaaagtg ttgatacttc tatgggcctt       660
     actccacttg aaggtgttgt aatgggaaca cgtagtggtg atgtcgatcc aagcttacac       720
     agcttccttg ctaaaaatct tggctgggac ttagcaaaaa tcgataaagt tttaaataac       780
     gaaagtggat tacttggctt atcacaactc tctaacgata tgcgtacagt gattgaagct       840
     gctgaaaatg gcaatgaaga tgcttgcctt gcgattgaag tatttagcta tcgccttgca       900
     aaatcacttg ctgccctaag ttgtggttta ccaagtattg atggcttgat ctttacaggc       960
     ggtattggtg agaactcagc ttatatacgt gaaaaaactc tagcttattt acctcatttc      1020
     ggtttacagc tcgataaaga ccagaacaac aatttaaaac gtggtacaga aggccgtatt      1080
     gatagcggca caggtccaca aatctgggtg attccaaccg atgaagaagg ccgtattgcc      1140
     aaagaaactc gtcaggttgt agaggtttca caaaatacat ctcctgaagt aagccttgct      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page