(data stored in ACNUC29543 zone)

EMBL: CP000521.PE469

CP000521.PE469       Location/Qualifiers
FT   CDS_pept        complement(535624..536466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10944"
FT                   /protein_id="ABO10944.2"
FT                   /translation="MTQHLSKHRHISFTAHYTGYIWYQMGISHEALATSKGKSLAYLVH
FT                   PLESWAEKYVGGSMRTTLKQRHTMLDHDLEKLIQENPDLQVLEIACGLSPRGWWFRQHY
FT                   PSISYRELDLPDMAQTKQNALQQIEKNAPEVLSVDLFTEAFAQAFEVFDSNRPLVVISE
FT                   GLINYFDKDLLKQLIQSIAHYGASFKKLHYLTDLYPEPVKNKLANIIWNSSKLLKLMSR
FT                   SSFSFHFKTPLEVKNFFKDAGFSQVNVEQPQIFFEQVSKDSDEEHLGDLVWTIHAQLK"
     atgacacaac acctttcaaa acaccgccac atttctttta cagcccacta tacaggctat        60
     atctggtatc aaatggggat ctcacatgaa gcacttgcca ccagcaaagg aaaatcgttg       120
     gcatatttag ttcacccatt agagtcttgg gcagagaaat atgtgggcgg cagtatgcgc       180
     acgacgctta aacagcgcca taccatgctt gatcatgatt tagagaagtt aattcaagaa       240
     aatcctgatt tacaggtgct tgaaatcgct tgtggtttat cacctcgagg ctggtggttt       300
     aggcagcatt atccttccat tagctatcga gagcttgatt tacccgatat ggcacaaacc       360
     aaacaaaatg cattacaaca aattgaaaaa aatgcacctg aggttttatc agtcgattta       420
     tttaccgaag cctttgctca agcatttgaa gtgtttgact ctaaccgccc actggttgta       480
     attagtgaag gtttaattaa ctattttgat aaagacttat taaagcaact gatccaatcc       540
     attgcccact atggtgcttc ctttaaaaag cttcattatt taaccgacct gtatcctgaa       600
     cccgttaaaa acaaacttgc taatattatc tggaacagca gtaaattact taaacttatg       660
     tctcgaagtt catttagttt tcattttaag actcccctag aagtgaaaaa cttttttaaa       720
     gatgcaggct ttagtcaagt taacgttgaa caacctcaaa tattctttga acaagtttct       780
     aaagacagcg atgaagagca tttaggcgac ttagtctgga ctatccatgc tcaattaaaa       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page