(data stored in ACNUC29543 zone)

EMBL: CP000521.PE476

CP000521.PE476       Location/Qualifiers
FT   CDS_pept        542611..543042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0498"
FT                   /product="nucleoside diphosphate kinase"
FT                   /note="NDK; NDP kinase; Nucleoside-2-P kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10951"
FT                   /db_xref="GOA:A3M207"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M207"
FT                   /protein_id="ABO10951.2"
FT                   /translation="MAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQA
FT                   DAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIR
FT                   ADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR"
     atggcaattg aacgtacttt gtctatcgta aagccagatg ctgtgtctaa aaaccacatc        60
     ggtgaaattt ttgctcgttt cgaaaaagcg ggtttaaaaa ttgttgcgac taaaatgaaa       120
     cacctttctc aagctgatgc tgaaggtttc tatgcagagc acaaagaacg cggtttcttt       180
     ggtgacttag ttgcattcat gacttctggt ccagttgtag tatctgttct tgaaggtgaa       240
     aacgcagttc ttgctcaccg tgaaatctta ggtgctacaa accctaaaga agcggctcct       300
     ggtactatcc gtgctgattt cgctgtaagc atcgatgaaa atgctgctca cggttctgac       360
     tcagttgctt ctgcagagcg tgaaattgct tacttctttg ctgacaacga gatctgccca       420
     cgcactcgtt aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page