(data stored in ACNUC29543 zone)

EMBL: CP000521.PE477

CP000521.PE477       Location/Qualifiers
FT   CDS_pept        543165..544397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0499"
FT                   /product="putative Fe-S-cluster redox enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10952"
FT                   /db_xref="GOA:A3M208"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M208"
FT                   /protein_id="ABO10952.2"
FT                   /translation="MSSAVVVSSENLDGQQQSSSTPASPAAEKVNLLGMSRAELEKFFE
FT                   DIGEKKFRAGQVMKWIHQYFVTDFAEMTNISGKLRAKLEQICEIKAPEVVHRHYSKDGT
FT                   RKWVFRVGEGSGSLVETVLIPAEDKTGSRKTLCISSQVGCALDCSFCSTGKQGFQRDLT
FT                   PDEIIGQLWMANYSYMEEVPVAERERSVTNVVMMGMGEPLLNYDAVLSSMHIMLDDFAY
FT                   GMSKRRVTLSTSGVVPKIDQLAKDIDVALAISLHAPNDELRNELVPINKKYPLAQLIAA
FT                   CQRYIAKDGNESARKHVTIEYVMLEGVNDQPEHAQQLLKLLKNLPSKINLIPFNPFPHA
FT                   PYGRSSRNRIISFQKTLSDAGFVCTIRQTRGDDIDAACGQLVGQVADRTRRAEQWQKKV
FT                   AQRQEILRTQG"
     atgagttctg cagtggtcgt ttcatctgaa aatcttgatg gacagcagca atcttcgtcc        60
     acgccagcat cgcctgctgc cgaaaaagtg aatttactcg gcatgtcacg tgctgaatta       120
     gaaaaattct ttgaagatat tggtgagaaa aagtttcgtg ccggtcaggt tatgaaatgg       180
     attcatcaat actttgttac tgattttgct gaaatgacta atatttcagg caaattgcgt       240
     gcaaagcttg aacaaatttg tgaaattaaa gctcctgaag tggttcaccg tcactattca       300
     aaagacggaa cacgtaaatg ggtgtttcgc gtaggtgagg gttctggctc tttagtagaa       360
     actgtattaa ttcctgccga agataaaaca ggttcacgca aaactttgtg tatttcttca       420
     caagtgggct gcgcattgga ctgctcattt tgttcaacag gtaagcaagg ttttcagcgc       480
     gatttaacac cagatgaaat tattgggcaa ctttggatgg caaactattc ctatatggaa       540
     gaagtgcctg ttgctgagcg cgagcgttca gtgactaatg ttgtgatgat ggggatgggt       600
     gagccattgc tcaactacga tgctgtatta agctcaatgc acattatgct cgatgacttt       660
     gcttatggta tgtcaaaacg tcgtgtgact ttgtcaacgt caggtgttgt gccaaaaatt       720
     gaccaacttg caaaagatat tgatgttgct ttagcaattt ccctacatgc gccaaatgat       780
     gaattgcgta atgaacttgt gcctattaat aaaaaatatc cattggctca gttgattgcg       840
     gcatgtcagc gttatattgc aaaagatggt aatgaaagcg cgcgtaaaca tgtgaccatt       900
     gaatatgtca tgttagaagg tgtgaacgac caacctgaac atgcacagca gttgcttaaa       960
     ttacttaaaa acttaccaag taaaattaac ttgattccat ttaatccgtt ccctcatgcg      1020
     ccatatggac gctcaagtcg aaatcgtatc atctctttcc aaaaaacttt gtctgatgca      1080
     ggatttgtgt gtacgattcg tcaaacacgt ggcgatgata ttgatgccgc atgtggacaa      1140
     ttggtcggcc aagttgctga ccgtacgcgt cgtgctgagc agtggcaaaa gaaagtggct      1200
     caacgacaag agattttacg tacacaagga taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page