(data stored in ACNUC29543 zone)

EMBL: CP000521.PE478

CP000521.PE478       Location/Qualifiers
FT   CDS_pept        544437..545213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0500"
FT                   /product="type 4 fimbrial biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10953"
FT                   /protein_id="ABO10953.2"
FT                   /translation="MLCMGVAVALLASGCQTSQTVKKDPEKAVKVRTQLAAEYIRSGDL
FT                   DSAKRSLDQALSVDSRDATANMMMGILLQQEGSKPNLEKAEHYFKRAISSEPDNAQAHN
FT                   NYGTYLYQMERYNDAIEQFRIAGATLGYDQRYQALENLGRIYLKLGDIASAEKTFKQAL
FT                   LANRDSYISMLELAEIFYLQQQIPAATQMYEQYVRTVGQKNQGARALWIGLRVARANAD
FT                   KMGMQVLVNQLRALFPESPEYQRYLQLQYSTEAVWK"
     atgttatgta tgggggttgc tgttgcactt ttggcaagtg gttgtcagac ttcgcaaacg        60
     gttaaaaagg acccggaaaa agcagtaaaa gtgcgtacgc agcttgctgc cgaatacatt       120
     cgttctggtg acttggattc tgcaaagcgt tctcttgacc aagcgttaag tgtcgatagt       180
     cgtgatgcaa cggcaaatat gatgatgggt attttattgc aacaagaagg cagtaaaccc       240
     aatttagaaa aagcggaaca ttactttaag cgtgcaattt cgtctgaacc agacaatgct       300
     caggcacata ataattatgg tacgtatttg taccaaatgg agcgttataa tgatgctatt       360
     gagcaatttc gtattgctgg tgcaacatta ggctatgatc aacgttacca ggctttagaa       420
     aatctggggc gaatttattt aaaactaggc gatattgcga gtgctgaaaa aacattcaaa       480
     caagcacttc ttgctaaccg cgactcttac atttcaatgt tagagttagc agaaattttt       540
     tatttgcagc agcagattcc ggctgctaca caaatgtatg aacaatatgt tcgtacagtg       600
     gggcagaaaa atcagggtgc acgcgcactt tggattggtt taagagtggc tcgagccaat       660
     gcggataaaa tgggaatgca agttttagta aaccagttac gtgctttatt cccggaaagt       720
     ccagaatatc aacgttattt gcaattacag tatagtactg aggccgtatg gaaataa          777
//

If you have problems or comments...

PBIL Back to PBIL home page