(data stored in ACNUC29543 zone)

EMBL: CP000521.PE479

CP000521.PE479       Location/Qualifiers
FT   CDS_pept        545204..545995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10954"
FT                   /protein_id="ABO10954.2"
FT                   /translation="MEINPNSQQPTGSSLPTSALGNIQRPGEYLRQIRVSQKKELEQVS
FT                   SDLNMPLKTLNALEQDDYKSLPEATFIKGYYRSYAKYLNTDATAIIQRFDEIYANDTGL
FT                   LPNHALNNSPIKIMGKLPGSNSDRNKKWLKRALLAILIIAVVSLIVMGVQKWTSNKEDA
FT                   ELPKANQSNVEVLPMKGNTSATVGDQLVLNFNRPTSVHIVDATGKVLATGRQASTLTLN
FT                   GESPFQIRLDDATAVSLSLNQEQISLSPYTVNGKAEFRLSR"
     atggaaataa atcctaattc acagcagcca actggctcaa gcttaccgac ttctgcttta        60
     ggaaatattc aacgtcctgg tgagtattta cgtcaaattc gtgtttctca gaaaaaagaa       120
     ttagagcaag tatcttcaga tttaaatatg ccgctgaaaa cgctcaatgc gttagagcaa       180
     gacgactata aatctttgcc agaagcgact tttatcaaag gctattatcg ttcttatgcg       240
     aagtatttaa atactgatgc aactgcaatt atccagcgtt ttgatgagat ttatgcaaac       300
     gatactgggc ttttgccaaa tcatgcttta aacaattcac caattaaaat catgggtaaa       360
     ttaccgggtt ctaatagtga tcgtaacaaa aaatggttaa agcgcgcact gcttgcaatt       420
     ttgattattg ctgtcgtgtc attaattgtg atgggtgtcc aaaaatggac ctcaaacaaa       480
     gaagatgctg agctgccaaa agcaaatcag tctaatgttg aagttttacc tatgaaaggg       540
     aacacctctg caacagtggg tgaccaattg gtgttaaact ttaaccgtcc aacttctgtt       600
     catattgtag atgcaacagg gaaggtttta gcgacgggtc gtcaggcatc gactttaacc       660
     ttaaatggtg agtctccatt ccagattcgt cttgatgatg caacggctgt gtcattaagt       720
     ctaaaccaag aacagatttc attgtctcca tatacggtaa acggtaaagc tgaattccgt       780
     ttatcccgct aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page