(data stored in ACNUC29543 zone)

EMBL: CP000521.PE483

CP000521.PE483       Location/Qualifiers
FT   CDS_pept        549148..550293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10958"
FT                   /protein_id="ABO10958.2"
FT                   /translation="MNQKFKLPLAIAIASAVLVGCSSNKVKEAKPNPLPKLTESNKSLV
FT                   PVFSRSVSSTNKADPLRLQLDASEGVVFTLDPKGEVAAYRGKQRLWEKKVSKLGLSSGV
FT                   EAAEGIVVVGNSKGQLFALDQATGEQKWTAQLSGALLSPSLVQSGRVITIANDGTVFAH
FT                   DVSSGQQVWAYKLPNVQFSLRGQPSPVSLDPRTVLIASANAYVYAIDTISGIPRFQRRV
FT                   AVSEGRSDIQRLIDIDGDPVVAGQLMVTTSFQGQVTVTDLASQRVVWSEDSSSTKRPEV
FT                   YDNKVFVSSTDGKLTAYDLTTGEQLWQNDSLLNRHLSNPVVLGSDLIVGDLDGVLHLID
FT                   PTTGKLIGRSKTSGEVNTLRVIENQLYVSTRKGDLSIWQNR"
     atgaatcaga aattcaaact gcctttggca attgcaatcg catcggctgt attggtcgga        60
     tgttctagca acaaagtaaa agaagcaaaa ccaaatccac taccgaaatt gaccgagtca       120
     aataagagtt tggtgcccgt gttttcacgc agtgtttctt ctacgaataa ggcagatcca       180
     ttacgtttac aacttgacgc tagcgaaggt gttgttttta cccttgatcc taaaggtgaa       240
     gttgctgcat accgtggtaa acaacgtctt tgggagaaaa aagttagtaa attgggttta       300
     agctctggtg ttgaagcagc tgaaggtatt gttgttgttg gtaacagtaa aggtcagtta       360
     tttgctttag atcaggcaac gggtgaacaa aaatggactg cacaattatc cggtgcttta       420
     ttaagtcctt ctttagttca gtctggccgc gtgattacaa ttgcaaatga cggtactgta       480
     tttgcacatg atgtatcatc aggacaacaa gtttgggcat ataaattgcc aaatgttcag       540
     ttcagtttac gtggtcaacc atcgccagtg agtcttgacc ctcgcacggt tttaattgct       600
     tctgcaaatg catatgttta tgcaattgat acgattagtg gtattccgcg cttccaacgc       660
     cgtgttgcag taagtgaagg gcgttcagat attcagcgtt taattgacat tgatggtgat       720
     ccggttgttg cgggtcaact catggtaaca actagtttcc aaggccaagt aactgttact       780
     gatcttgctt ctcaacgtgt ggtttggagt gaagattcaa gtagcaccaa gcgtccagaa       840
     gtttatgata ataaagtgtt tgtttcgtca actgacggca agcttactgc ttatgactta       900
     acaacaggcg aacagctttg gcaaaatgat agtctcttaa accgtcattt aagtaatcct       960
     gtcgtgttgg gatcggacct tattgttggt gatttggatg gtgttttaca cctaatcgac      1020
     ccgacaacag gtaagttgat tggtcgttct aaaacaagtg gtgaggtcaa tacattacgt      1080
     gtgattgaga atcagctcta tgtttcgacc cgaaaaggcg atttaagtat ttggcagaat      1140
     cgttaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page