(data stored in ACNUC29543 zone)

EMBL: CP000521.PE484

CP000521.PE484       Location/Qualifiers
FT   CDS_pept        550481..551890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0506"
FT                   /product="putative GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10959"
FT                   /db_xref="GOA:A3M215"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M215"
FT                   /protein_id="ABO10959.2"
FT                   /translation="MKPVIALIGRPNVGKSTLFNQITKSRDALVADFAGLTRDRKYGDA
FT                   TYQNKSFIVVDTGGIGESEGGIDNYMAEQSKTAINEADIIIFVVDARAGLLASDEQIAR
FT                   ELRTLGKKIYLVANKVDGVHAEAALVEFYKLGMGEPLQVAASHGRGVQQMLEDVLQDIP
FT                   EDENPEEHDKDTGLRLAIIGRPNVGKSTLVNRLLGEDRVVAFDQPGTTRDSIYIPFERE
FT                   GRKYTLIDTAGVRRKGKVDEMIEKFSIVKTLQAMKDAHVVVVVVDAREGIVEQDLHLIG
FT                   YALEAGRAMVIAINKWDNMSEYDRKQCKLDVERRFDFIPWARIHLISALHGTGVGELYP
FT                   SIHRAYESANLKVSPAKLTQILNDATDQHQPPTVQGRRIKMRYAHMGGQNPPTIVIHGN
FT                   KVDKTPADYRRYLENVFRKVYKLEGTPVKIEFKTSENPFEGRKSQVDERTAARRRRYIQ
FT                   KFKKAEKKFKR"
     atgaaacccg ttattgcgct cattggtcgt ccgaatgtcg gaaaatcaac gttatttaac        60
     cagattacca agagtcgtga tgcacttgta gccgacttcg cgggtttgac tcgtgaccgt       120
     aaatatggtg atgcgactta tcaaaataag tctttcattg ttgttgatac tggcggtatt       180
     ggtgaaagtg aaggcggtat cgataactac atggccgagc agtcgaaaac agccatcaat       240
     gaagccgata ttattatttt tgtagttgat gcgcgtgctg gattgttagc ttccgatgag       300
     caaattgccc gtgaattacg tactttaggc aagaaaattt atcttgttgc caataaggtt       360
     gatggtgttc atgctgaagc tgctttggtt gagttctaca agcttggtat gggtgaacca       420
     ttacaagttg cagcgagcca tggccgtggc gtacaacaaa tgcttgagga tgtacttcaa       480
     gatattccag aagatgaaaa tcctgaagag catgataaag ataccggatt gcgtctagca       540
     attattggtc gtccgaacgt gggtaaatca acgttagtaa accgcttact tggtgaagac       600
     cgtgtggtag cgtttgacca accgggtaca actcgtgact ctatttatat tccgttcgag       660
     cgtgaaggtc gtaaatacac tttaattgat acagcaggtg tacgccgtaa aggtaaagtt       720
     gatgaaatga ttgagaagtt ctcaattgtg aagactttac aagcgatgaa agacgcacat       780
     gtggtggtgg ttgtagttga tgcccgtgaa ggtattgttg agcaagactt acatttaatt       840
     ggctatgcgc tggaagctgg gcgtgccatg gtcattgcga tcaataaatg ggacaacatg       900
     agtgaatacg accgcaagca gtgtaagctt gatgttgagc gccgttttga ctttattcct       960
     tgggctcgaa ttcaccttat ttctgctcta catggtactg gggtgggtga gttatatcca      1020
     tcaattcacc gtgcttatga gtctgcaaac ttaaaggtat ctcctgcgaa attgacgcag      1080
     attttgaatg atgcaactga tcagcatcag ccgccgacag ttcaaggccg tcgtattaaa      1140
     atgcgttatg cgcacatggg cggacaaaat ccaccgacta ttgtgattca cggtaacaag      1200
     gtggataaga ctcctgcaga ttaccgccgt tatttagaga atgtgttccg taaggtttat      1260
     aagcttgaag gtacaccagt taaaattgaa tttaagactt ctgaaaaccc gtttgaaggc      1320
     cgtaagagtc aggtcgatga gcgtacagct gcacgtcgtc gtcgttatat tcagaaattc      1380
     aaaaaagcag aaaagaaatt taaacgttaa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page