(data stored in ACNUC29543 zone)

EMBL: CP000521.PE490

CP000521.PE490       Location/Qualifiers
FT   CDS_pept        554033..554563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0511"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10964"
FT                   /protein_id="ABO10964.2"
FT                   /translation="MTALFVLYPFIVGWSLSHGQFVWVSALLIGLGVIRLFSKGNSLLW
FT                   PLTGFAIVCGSLSLLSHDHAWLKLYPVGMSLGALIIFALTLIKPPSMIERFARLVEPDL
FT                   PASGVQWTRQVTKIWCVFFFCNALIALSTVLFTSTQVWVIYNGFISYVLMGILFLGEFI
FT                   LRKRHQRLHSSNH"
     atgacggcac tttttgtgct gtatcccttt attgtgggct ggagtttgag tcacggccaa        60
     tttgtctggg tgagtgcttt actcatcggg ttgggtgtga tcagactttt tagcaaaggc       120
     aactcgttat tatggccatt aacgggtttt gccatcgttt gtggtagcct gagtttgttg       180
     tcacatgacc atgcttggct aaagctgtat ccagtgggta tgagtttagg tgcattaatt       240
     atttttgcgc tgacgctcat taagccgccg tctatgattg agcgctttgc ccgactcgtt       300
     gaacctgatt tacctgcttc cggtgtacag tggaccagac aggtcaccaa aatttggtgt       360
     gttttctttt tttgtaatgc attgattgct ttaagcactg tgctttttac ctcaactcag       420
     gtttgggtca tttataatgg ctttatttct tatgtgctga tgggcatttt gttccttggt       480
     gaatttattt tgcgtaagcg acatcagcgt ttacattctt caaatcatta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page