(data stored in ACNUC29543 zone)

EMBL: CP000521.PE493

CP000521.PE493       Location/Qualifiers
FT   CDS_pept        556977..557903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10967"
FT                   /protein_id="ABO10967.2"
FT                   /translation="MTDSASPKWNDIKERGGMLPLMLMLWFYRFGGRWLCKFVMYFVIM
FT                   WYWLFAVTARQASLLYLQKLHHFAGSQSPFNHQPNWTNSYAHFMQFGECILDKIEGWLG
FT                   NIPEQELQVFGHENFSQHYQKGALIIVSHFGNIELLRAIKSEHPQKINVLVYQKHATKF
FT                   NEFLKKINDKADVCLLSVDELGIETAMLLQDKMQQGEWVIVAADRVPVQSDRVQHVDFL
FT                   GESAAFPQGAWILANLLKVPVIAVFCYRVQQQFQVHIHSIAEQINLPRANRIESMQTIT
FT                   KTYVAVLEQHCLRAPYQWFNFYNFWTK"
     atgacagatt cagcttcacc aaaatggaac gacattaaag agcgaggcgg gatgttgccc        60
     cttatgctga tgttgtggtt ttaccgtttt ggtggacgtt ggttatgcaa gtttgtgatg       120
     tacttcgtca tcatgtggta ctggttattt gctgtcacag caagacaggc gtccttactt       180
     tatttacaaa aactgcatca ttttgctgga tcacagtcgc cgtttaacca ccaaccaaat       240
     tggacaaaca gctatgcgca tttcatgcaa tttggcgaat gtattttaga taagattgag       300
     ggctggctag gcaatattcc cgagcaggaa ctgcaagttt ttggacatga aaacttctct       360
     cagcattatc aaaaaggtgc tctgattatt gtctctcact ttggcaatat tgaattgctt       420
     cgagccatta agtcagagca tccgcagaaa attaatgtgc tggtttacca aaagcacgcg       480
     acaaaattta atgagttttt gaaaaaaata aatgataagg cagatgtttg tcttttatca       540
     gttgatgagc tgggtattga aactgccatg ctattgcaag acaaaatgca gcaaggtgag       600
     tgggtcattg tagcggcaga ccgagtgcct gtgcagtcag atcgtgtaca gcatgttgat       660
     tttttagggg agtcagcagc tttcccacaa ggtgcatgga ttttagcaaa tttactcaaa       720
     gtgcctgtta ttgctgtgtt ttgctatcgg gtgcagcagc agtttcaagt gcatattcat       780
     tcaattgccg agcagataaa tttacctcgt gctaaccgta ttgaaagtat gcaaaccatc       840
     actaaaacat acgttgccgt actagaacag cattgtctgc gtgcccctta tcaatggttt       900
     aatttttata atttttggac gaaataa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page