(data stored in ACNUC29543 zone)

EMBL: CP000521.PE494

CP000521.PE494       Location/Qualifiers
FT   CDS_pept        557905..559440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0515"
FT                   /product="histidine ammonia-lyase protein"
FT                   /note="histidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10968"
FT                   /protein_id="ABO10968.2"
FT                   /translation="MRVLTVGEQPLSIEDVVSVARGECQVALPETSEWRELIQKGADFL
FT                   DQLLEEEGVIYGVTTGYGDSCLVEVPLHQVNELPLHLSRFHGCGLGENLDVITARAVVV
FT                   TRLCSLARGYSGVSIALLERLVWLLNENVIPVIPSEGSVGASGDLTPLSYIAGTLVGER
FT                   DVYIDGQIVPVAQVYAEKNMLPLTLRPKEGLALMNGTAVMTAIACLNYKKAEQIALAST
FT                   LITALNVLALEGNPSHFDEVLFAQKPHPGQQHIAKQLRDWLNSEVQTAHQSPRLQDRYS
FT                   LRCAPHIIGVFEDSKVWLRQFIENELNSSNDNPLIDPVGMRVLHGGHFYGGHIAQAMDS
FT                   LKIMIANIADLMDRQIAQLVDHKMNHGLPRNLTGATAERLPLNHGFKAVQIGVSAWTAE
FT                   ALKNTLAASIFSRSTECHNQDKVSMGTIAARDASRVITLTQQVIAALCCASVQAIHLKG
FT                   LTTQLSPTLQAFMQWTLQSFAFVEEDRPLQTELQQIVDRLDQLELFNQPEFMG"
     atgcgtgtgt taaccgtagg tgaacagcca ctgagtattg aagatgtcgt ttctgtagcc        60
     agaggcgaat gtcaggttgc tttaccagaa acgtctgaat ggcgtgaact gattcaaaaa       120
     ggcgctgatt ttctcgatca gctccttgaa gaggaagggg ttatctacgg tgtgactacg       180
     ggttatggcg actcatgttt agttgaagtg ccattgcatc aggttaatga attaccgctg       240
     catctttcac gttttcatgg ttgtggttta ggtgaaaatt tagatgtcat cactgcacgt       300
     gcagtagttg tgacgcgttt atgttcgtta gctcgcggct attcaggcgt gtcgatcgct       360
     ttgctggaac gcttagtttg gttgctgaat gaaaatgtaa ttccagttat tccatctgaa       420
     ggttcagtcg gggcaagtgg ggatttaacg ccgttgtcct atattgcggg aactttagtt       480
     ggtgagcgtg atgtctatat cgatggacaa attgttccag ttgctcaggt gtatgctgaa       540
     aaaaatatgc tgcctttaac gcttagacct aaagaaggtt tggcgctcat gaacggcaca       600
     gcggtgatga cggcaattgc ttgtctaaac tataaaaaag cagagcaaat tgcacttgca       660
     agtactttaa ttactgctct aaatgtattg gctttggaag gtaatcctag tcattttgat       720
     gaagtcctgt ttgcacagaa gccccatccg ggacagcaac acattgccaa gcaattacgt       780
     gactggctga atagtgaagt acaaacagca catcaaagcc cacgtttgca agaccgttat       840
     tcgcttcgtt gtgcaccgca tattattggt gtgtttgaag actcaaaagt atggttacgt       900
     cagttcattg aaaatgagtt gaactcaagt aatgacaatc cattgattga tcctgtaggg       960
     atgcgtgtat tgcatggcgg tcatttttac ggtgggcaca ttgcacaagc aatggatagc      1020
     ttgaaaatta tgatcgctaa tattgctgac ttgatggaca gacaaattgc acagttggtt      1080
     gaccacaaaa tgaatcatgg tttgccacgt aatttaacag gtgcgacagc tgaacgttta      1140
     ccactgaatc atggttttaa agcggtacaa attggggtgt cggcgtggac ggctgaagcc      1200
     ttgaaaaata ctttggcagc ttcaattttt tcacgttcaa ccgaatgcca taaccaagac      1260
     aaagtcagca tgggtaccat tgctgcgcgt gatgcgagcc gtgtgattac cctgacacag      1320
     caagtcattg cagcactttg ctgcgcgagt gtgcaggcga ttcatttaaa aggtttaacc      1380
     acacagttaa gtccaacatt gcaggcattt atgcaatgga ccttacaaag ctttgcattt      1440
     gtcgaagaag accgaccatt acaaaccgaa ttacaacaga ttgttgatcg tttagaccaa      1500
     cttgaattgt ttaatcaacc agaatttatg ggataa                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page