(data stored in ACNUC29543 zone)

EMBL: CP000521.PE495

CP000521.PE495       Location/Qualifiers
FT   CDS_pept        559450..559878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10969"
FT                   /protein_id="ABO10969.2"
FT                   /translation="MHADVIIEIPFHDVDTMNVVWHGHYLKYFEIARCKLLDQFHYNYM
FT                   QMKESGYAWPVIESHVRYAYGIEFEQKIRVRAILKEWENRLKIDYLIFDAESGKRLTKG
FT                   YTTQVAVNIEAREMCFQSPQVLFDRLNAWSEFQPKRNA"
     atgcatgcag atgtaatcat tgaaattcca tttcatgatg tcgataccat gaatgtggtt        60
     tggcatggac actatttaaa atattttgag attgcgcgct gcaaattgct cgatcaattt       120
     cattacaact atatgcagat gaaagaatca ggctatgcat ggcctgtgat tgaaagccat       180
     gttcgctatg catacggtat tgagtttgaa caaaagattc gggttcgggc cattttaaaa       240
     gaatgggaaa accgtttgaa aattgattat ttgatttttg atgctgagtc agggaaacgt       300
     ttaaccaagg gttataccac acaggtggcg gtgaatattg aagctcgtga aatgtgtttt       360
     caatcgccac aggttttgtt tgatcgcttg aatgcatggt ctgagtttca accgaagagg       420
     aatgcgtga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page