(data stored in ACNUC29543 zone)

EMBL: CP000521.PE498

CP000521.PE498       Location/Qualifiers
FT   CDS_pept        560482..562797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0519"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10972"
FT                   /protein_id="ABO10972.2"
FT                   /translation="MRFSNWQNKFTALWLIALLLVAVGLGVTWLNKDIHIQTNIFALLP
FT                   KVQQDPELARTQQYMNEQLNNKVFVVVDAKDEAAIQQATHFLTVQAKQSQLWQPLKPQL
FT                   DFDQFAKQLYQHRAGLLSAQDQALLQKKDYAALTEQSLMQMMSPGMPVTAESLKQDPLL
FT                   LFPRYAMQLATPSQQDIEMEQGFATIHHEQGISRLFVLQLTQSPYNIDYQEQTSTWIEQ
FT                   TKQKLAAMGLKSHWTGTILFSNFGTQSAKQEISTIGVGSTLGLIFLVWFGFRSLRPLAT
FT                   EFIAVSTGSFVAFAVTHWMFGEIHLMTLVFGASLIGVCVDFSFYFMAMQSQHRTLGGFQ
FT                   ILKPLLPSLFMGLMTTLVAYIFLSFTPFPGFKQIAVFSIVGLTAAWISSVLLLPRLPAL
FT                   NAQPAIKALSWIGQARLWFQQRTKIRYGLIAVILAVGTASLFYLKSNDDIRNLQGMDAS
FT                   LKQQDQVVREQFGQQQSSDYFVVRAASANEMQQQEQQLIGHLQQLQTNGKISAFQALGQ
FT                   WIPPLAEQQNNLQLLRNIPKATLQQYAQSMSLNVTDVLQWQQQLATQPLLDFSVFKDHP
FT                   LAFLQPQANERLVMVTGVKQPDALKQLQNEHIHFQQPITAMSQMFAEHRVQAQHLLIYA
FT                   LIGLAVGLALIYGLSSIVPLVLPVSLALLSTFAVQAWLGVEINLFSIMATFLIIGIGVD
FT                   YAIFYRHGHDHPQVVGMALFLCMMSTLLGFGLLSFSHTYAIHCFGLTVLFGVIFSFIYA
FT                   TLLTPADEKHIVNLQDHS"
     atgcgatttt ccaactggca aaataagttc accgcgcttt ggttaattgc tctgctattg        60
     gttgctgtgg ggcttggcgt gacgtggctg aataaagata ttcatattca aactaatatt       120
     tttgcgttat tgcctaaagt tcagcaggac ccagaacttg cacgtactca gcagtacatg       180
     aatgagcaac tcaacaataa agtatttgtg gtggtagatg ccaaagatga agctgcgata       240
     caacaagcga ctcatttctt aacagtgcag gccaaacaaa gccagttgtg gcaaccgctg       300
     aagccacaac ttgattttga tcaatttgca aaacagttgt atcaacatcg agcaggtctg       360
     ttgagtgctc aagatcaagc cttattgcaa aaaaaggatt atgctgcgct gactgaacaa       420
     agtctgatgc agatgatgag tccaggcatg cctgtcactg ctgagtcact taagcaagac       480
     ccgttactgt tgttccctcg ttatgccatg cagttggcaa ccccgtcaca gcaagatatt       540
     gaaatggagc agggctttgc cacaattcat catgagcaag gcatttctcg gcttttcgta       600
     ttacagctaa cgcaaagtcc atacaatatt gattaccaag aacagacctc tacttggatt       660
     gaacaaacta agcaaaagct agcggcaatg ggattaaaat ctcattggac tggaactatt       720
     ttattttcaa attttggtac gcaatcggct aaacaggaaa tctcaaccat tggtgttggc       780
     tcaacattag gcttaatttt tctggtttgg ttcggctttc gctcactgcg acctttggca       840
     accgagttta ttgcagtttc gactggaagc tttgtggcat ttgccgtgac ccactggatg       900
     tttggggaaa ttcacctgat gacattggtc tttggcgcaa gtttgattgg tgtctgtgtc       960
     gatttttcat tttattttat ggcgatgcaa tcgcagcata gaacgcttgg tggttttcaa      1020
     attttaaaac cgctattacc aagtttgttt atgggtttaa tgaccacatt ggttgcttac      1080
     atctttttga gttttactcc gtttcctggg ttcaagcaga ttgcagtctt ttcaattgta      1140
     ggattaactg cggcgtggat cagtagtgta ctgctattac caagattacc tgcactcaat      1200
     gcccagccag caataaaagc tttatcgtgg attggacaag cacggttatg gtttcagcaa      1260
     cgaaccaaaa ttcgttatgg cttgattgcg gtcattttag cagtaggtac ggcaagtctt      1320
     ttctatctta aaagtaacga tgatattcgt aacttacaag gtatggatgc gagcttaaaa      1380
     cagcaggacc aagttgttcg tgagcaattt ggccagcagc aaagtagtga ttattttgtg      1440
     gtacgtgcag catctgcaaa tgaaatgcag caacaagagc agcaactgat tggacatttg      1500
     caacagttgc aaacaaacgg aaaaatcagt gcatttcaag ctttaggtca atggattcca      1560
     ccattggcag agcagcaaaa taatctacaa ctattaagaa atattccaaa agcgactttg      1620
     cagcaatatg cacaaagcat gagcctaaat gtcactgatg ttttacagtg gcaacagcaa      1680
     ctagcgacac aaccgttatt agatttttca gtatttaaag atcacccttt agctttttta      1740
     caacctcaag ccaatgagcg attagtcatg gtgacagggg tgaaacaacc tgacgcgtta      1800
     aagcaacttc agaatgagca tatacatttc cagcaaccga ttactgcaat gtcacaaatg      1860
     tttgctgaac accgagtgca ggctcaacat cttctgattt atgccttaat tggtctggca      1920
     gttggtttag cgcttattta tggattaagt tcgattgtac ctttggtctt gccagtcagc      1980
     ttggctttac taagcacttt tgctgttcag gcatggttag gtgtcgagat taacctgttt      2040
     agtattatgg cgactttcct gattattggg attggtgtcg actatgcaat tttctaccga      2100
     catggacatg atcatccaca agtagttgga atggcattat ttttatgtat gatgtcgacc      2160
     ctactgggct ttggattact ttcatttagc catacttatg caatccattg ttttggttta      2220
     acggttttat tcggggttat tttctcgttt atctatgcga ctttgttaac gcccgcagat      2280
     gaaaaacata ttgtaaattt acaagaccat tcataa                                2316
//

If you have problems or comments...

PBIL Back to PBIL home page