(data stored in ACNUC29543 zone)

EMBL: CP000521.PE500

CP000521.PE500       Location/Qualifiers
FT   CDS_pept        564125..564670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10974"
FT                   /protein_id="ABO10974.2"
FT                   /translation="MQRKWATILLSSFIFLNGCQVMPHAKGLQSPLWQAQTYQRQDQVE
FT                   VQWKQQSFSFLLYQQQKGAVLDMVALSLTGQQLFKLQFDGHRVHVEQRIDQMRLLPFEF
FT                   VVRDLLFATYPQFSHLGQQAVEMKQQADKQVVYIEKQPVLQVKQGQGSIELINEQVPYT
FT                   MTLSSIENTLQTEESSTP"
     atgcaacgca aatgggcaac gatattactc agtagcttta tatttttaaa tggttgtcag        60
     gtcatgccac atgctaaagg gctgcaaagt cctctatggc aggctcagac ttatcaaagg       120
     caagatcaag ttgaagttca gtggaagcag caaagtttta gcttcttgtt atatcaacag       180
     caaaagggtg ctgtactgga tatggtcgct ttaagcctga caggccagca attatttaag       240
     ttacagtttg atgggcatcg ggttcatgta gaacagcgta ttgatcaaat gcgtttattg       300
     ccttttgagt ttgtggtgcg tgaccttttg tttgcgacat accctcagtt ttcgcattta       360
     gggcagcaag ctgtagagat gaaacaacaa gcagacaagc aggttgttta tattgaaaag       420
     cagcctgtgt tgcaggttaa acaagggcaa ggaagcattg aattgattaa tgaacaagtc       480
     ccttatacca tgacgctgag ttcgattgag aacactttgc agacagaaga aagttctacg       540
     ccatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page