(data stored in ACNUC29543 zone)

EMBL: CP000521.PE502

CP000521.PE502       Location/Qualifiers
FT   CDS_pept        565869..566294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0523"
FT                   /product="putative 3-hydroxylacyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10976"
FT                   /protein_id="ABO10976.2"
FT                   /translation="MKLDAIQYIPHEQPMVFIDHLTEVAEGRAQAELTITPELMFCEAE
FT                   GLPTWASIEIMAQTISAYSGWQGQQSKQAPKVGFLLGTRKLNLPIPYFALGSRLIIQIE
FT                   QQYFHEGLGQFSCEIQYAEHCIQATLSVFEPTESPFE"
     gtgaaactag atgcaattca atatattcct catgagcaac cgatggtatt tatcgaccat        60
     ttaactgagg ttgcagaagg gcgggcgcaa gcagaactca caattacgcc agagctgatg       120
     ttttgtgaag cagaaggttt gccgacatgg gcaagcattg aaattatggc gcaaacgatt       180
     agtgcttatt ccggctggca aggtcagcag tcaaaacaag cgccaaaagt cggtttttta       240
     ttgggaacgc gtaagttaaa tttaccgatc ccttatttcg ccttaggttc acgattgatc       300
     attcaaatag aacaacaata ttttcatgaa ggacttgggc aattttcctg tgaaattcaa       360
     tatgctgagc actgcattca ggcaacgtta agtgtatttg agccaacaga atcaccattt       420
     gaataa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page