(data stored in ACNUC29543 zone)

EMBL: CP000521.PE505

CP000521.PE505       Location/Qualifiers
FT   CDS_pept        568281..568715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10979"
FT                   /protein_id="ABO10979.1"
FT                   /translation="MLNKKLLFVAMLSAGFTATVQAADEVHHLNFKEAVDRAVADGTLD
FT                   GSVKFYLKGTKSGGKVIQKDAVTNKKTNGFGKSAATSCDWVLRSALIQMQNNAKAQGAN
FT                   AVTNIVSYFKANETTSTTTYDCYKGTMMAGVALKGDVVKF"
     atgttaaata aaaaactttt atttgtagca atgctaagtg cgggttttac tgccactgtt        60
     caggctgctg atgaagtaca tcatttaaat tttaaagaag ctgtagaccg tgcagtcgct       120
     gatgggactc tggatggttc tgtaaagttt tatttaaagg ggacaaagtc tggcggtaaa       180
     gttattcaaa aagatgcggt aaccaataaa aagaccaatg gttttggtaa gtcggcagca       240
     acttcttgtg actgggtttt acgttcagca ctgatccaaa tgcaaaacaa tgctaaagca       300
     caaggggcaa atgccgttac caatatcgtg agctatttta aagccaatga aacaacgagt       360
     acgacaactt acgattgcta taaaggtact atgatggcgg gtgttgcttt aaaaggcgat       420
     gtcgttaaat tctaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page