(data stored in ACNUC29543 zone)

EMBL: CP000521.PE506

CP000521.PE506       Location/Qualifiers
FT   CDS_pept        568739..569395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0527"
FT                   /product="putative holo-(acyl carrier protein) synthase 2"
FT                   /note="AcpT; phophopantetheinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10980"
FT                   /protein_id="ABO10980.2"
FT                   /translation="MSKRKIEVYTQALSQLLLKSKQDFPDFRSFNHYKKQQIKSVRNRL
FT                   IAEKLRLTSMELEFAKHEHGKPYLLNHTLHFNHSHSQQYYALALSERIKDIGIDVEELD
FT                   RKVRLDSLAQHAFHPDEYATWQSLEQDREYWFKVWTTKEAVLKASGLGIRLDLNTLNTQ
FT                   AHPTNHGGLCSHELIGTFAYQNFVLGNMILTVAWRSEQSCRGFQFPSIQIHSLDR"
     atgtctaagc ggaaaattga agtctataca caggcattat ctcagcttct tttaaagtct        60
     aaacaagatt ttccagactt tcgttcattt aatcattata aaaaacaaca aataaagagt       120
     gtcagaaata gactgattgc agagaaacta cgactcactt caatggaatt ggagtttgcc       180
     aagcatgaac atggcaaacc ttatttattg aatcacactt tgcattttaa tcattcacat       240
     agccaacaat attatgcttt agcgctgagt gagcgaatta aagatattgg tatagatgtt       300
     gaagagcttg atcgtaaagt acgtctggat agtctggcac aacatgcttt tcatcctgat       360
     gaatatgcaa cgtggcaaag tctagaacaa gatagagaat attggtttaa agtctggacg       420
     actaaagaag ctgttttaaa agcatcgggt ctgggtatac gtttagattt aaatacctta       480
     aacacccaag cacatcctac aaatcatggc ggattatgtt cgcatgagct tattgggaca       540
     tttgcctacc aaaactttgt gttaggtaat atgatcttaa cagtcgcatg gcgttcagag       600
     caatcatgcc gtggattcca gtttccttct attcagattc attcacttga ccgttaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page