(data stored in ACNUC29543 zone)

EMBL: CP000521.PE51

CP000521.PE51        Location/Qualifiers
FT   CDS_pept        complement(57027..59213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0049"
FT                   /product="protein tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10544"
FT                   /protein_id="ABO10544.2"
FT                   /translation="MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRV
FT                   TPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSPAQAEIEILKSRLVLGTVIKDLHL
FT                   NIQVSSTENTLTHRLLSDADYKTEYTTKSVIFKDGLKSFDIRQFEIPAYYLDKNLLLDF
FT                   DKQSLRLTDPVTEEVILTVPLNQVNHVAGPHGLWKVAIFTKDQFDATYNIKSLSLPIAV
FT                   NAISANYAVAERGKLTGVLGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLK
FT                   FLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYLTQSITLETKKAELEQKQAE
FT                   MAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTA
FT                   LLNSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLLVLILSVFVGGFIGALIALLRN
FT                   MLRTGIKDSGQIENEMDLPVYATVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESL
FT                   RSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQGNKRVLLIDADMRRGY
FT                   MHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKEL
FT                   LEQLQSQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAG
FT                   VKVNGFILNDIQRASAGYGYGYNYAYAYKAQKED"
     atgaaccaac aaaatactaa taccgaagat acaattgact taaaagaatt gtttttttca        60
     ctgattgctc agtggaaact cattgctcta tgcgttattt taagcgttgt atgtgcccta       120
     ctatatttac gtgtaacgcc agatacctat tcggtagatg ctttagttca ggttgaggac       180
     agtaaagggg cttctgctgc acttttaggt gatctctcac aaatgattga gcaaaaatca       240
     ccggctcaag cagaaataga aattttaaaa tctcgtttgg ttttaggcac ggtcattaag       300
     gacttacatc taaatataca ggtctctagc actgaaaata cgcttaccca tcgcttattg       360
     agtgatgctg actataaaac tgaatatact acgaaatcag tcatttttaa ggatggctta       420
     aaaagttttg atatccgtca gtttgagatt cctgcttatt acttagataa gaacttactt       480
     cttgattttg ataaacaatc tttacgttta accgatcctg taactgaaga agtcatctta       540
     actgttccat taaaccaagt taaccatgtt gctggtcctc atggtttatg gaaagttgct       600
     atctttacaa aagaccaatt tgacgcaacc tataatatta aaagtctatc tttacctatt       660
     gctgtaaatg ctattagtgc gaattatgct gtggccgaac gcggcaaact tacaggagtg       720
     ttaggtctta actatcaagg tcaagacaaa gagcatatta ccaaagttct caatgcgatc       780
     ttagcgacct atagtgcaca aaatattgaa cgccgttcgg cagaatctgc tcaaacctta       840
     aaatttttag atgaacaact acctgacctg aaaaaacagc tagatgatgc agagcgtcaa       900
     tttaataaat tccgtcaaca gtataatacc gttgatgtga ctaaagaatc tgagctgtat       960
     ttaacccaaa gtattacttt ggaaactaaa aaagcagagc ttgagcagaa acaagctgaa      1020
     atggcagcta aatatactgc agagcaccca gcaatgcgtg aaattaatgg ccagctcgct      1080
     gcgattaata agcaaattgg tgagctcaat agtactttaa aacaattacc agatgttcaa      1140
     cgccaatatt tacagcttta tcgtgaagtt gaagttaaaa cacaactcta tacagccctt      1200
     ttaaactcat accaacaact tcgtattgcc aaagctggtg aaattggtaa tgtacgtatt      1260
     gttgacactg cagttgagcc agttgaacca attaaaccga aaaagttgtt agtccttatt      1320
     ttatcggtat ttgtgggtgg ctttattgga gctctaatag ccttattacg taatatgtta      1380
     cgtacaggta ttaaagactc tggtcaaatt gaaaatgaaa tggatttacc ggtttatgca      1440
     accgttcctc gttctccaat tcaagaaagc cgtatcaaga ttttaaagaa gaagaagagt      1500
     attcctattc ttgcggttaa aaacagtgat gatattgcca ttgaaagctt acgcagtatc      1560
     cgtacagcta ttcactttgc attagcaaat gcaaaaaata atatcattat gattgctggt      1620
     ccttctcctg aagtgggtaa atcgtttatt tcaactaact tggcaactat tttcgcgcaa      1680
     ggtaataaac gagtactatt gatcgatgcc gatatgcgcc gtggttatat gcataaatat      1740
     ttcgatgttg atgtgaagcc aggtctatca gaacttttaa gtggacaagc tgatttacaa      1800
     aaagtattgc acaaaactca ggtagccaat cttgatgtga ttactcgtgg taagagtcca      1860
     acaaatcctt cagagatttt aagctcaaac cagtttaaag aattacttga gcagctacaa      1920
     agccaatatg accacatcat tatcgatact ccaccagtgc ttgcagtaac cgatggtatt      1980
     attatttcgc aatatactgg tgtgaactta attgttgcac gctacgccaa gtcacaaatg      2040
     aaagagcttg aactaactgt taatcgtttt gaacaggcgg gtgttaaagt taacggcttt      2100
     attctcaatg atattcaacg tgctagcgct ggctatggtt atggctataa ctatgcttat      2160
     gcctataagg cacaaaaaga agactaa                                          2187
//

If you have problems or comments...

PBIL Back to PBIL home page