(data stored in ACNUC29543 zone)

EMBL: CP000521.PE512

CP000521.PE512       Location/Qualifiers
FT   CDS_pept        572637..573368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0533"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10986"
FT                   /protein_id="ABO10986.2"
FT                   /translation="MQSNNPILTRVETVSDYSQPMTVQGAIQKSVMLTIIAAAVGVALF
FT                   FYAAFTANVGIAYAASIVGAIGGLVLALITTFKPTTAPTLAIPYALFEGAFLGGISFTF
FT                   QLKYPGVPLQALLATFVTTLVMFGLYKFQIIRATEKFKSVVISASLAIFIVFIVQMVMR
FT                   LAFGSSIPYIFESNWLGIGFAAFVAVIASLNLILDFDLIETNAAYRAPKFMEWLCGIAL
FT                   LATLVWMYISFLRLLGLLSDD"
     atgcaaagta ataacccgat actgacacgc gttgaaacgg tcagtgacta tagtcaaccg        60
     atgaccgtgc aaggtgcgat tcaaaaatct gttatgttga ccatcattgc tgctgcagtg       120
     ggtgtcgctt tatttttcta tgcagccttt actgcaaatg ttggtattgc ttatgcggct       180
     tcaattgtgg gtgcaattgg cggcttggtt ttagctttaa ttacgacttt taaaccaacg       240
     actgcaccaa ctttagcaat tccttatgct ttatttgaag gggctttctt aggtggtatt       300
     tcttttactt tccagttgaa atatccgggc gttcctcttc aagcgttatt ggcaactttc       360
     gtcacgactt tggtgatgtt tggtctatat aagtttcaaa tcatacgcgc aactgaaaag       420
     ttcaaatcag ttgtgatctc tgcatctttg gcgatcttta ttgtatttat cgtgcagatg       480
     gtgatgcgtt tagcgtttgg ctcaagcatt ccttatattt ttgaaagcaa ctggttaggt       540
     attggttttg ctgcgtttgt tgcagtgatt gcttcactga acctaatttt agattttgat       600
     ttgatcgaaa ctaatgcagc atatcgtgca ccaaaattca tggaatggtt gtgtggtatt       660
     gccttacttg caactttagt atggatgtat atctcgttct tacgtttgct tggcttattg       720
     tctgacgact aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page