(data stored in ACNUC29543 zone)

EMBL: CP000521.PE515

CP000521.PE515       Location/Qualifiers
FT   CDS_pept        complement(575796..577790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0536"
FT                   /product="macrolide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10989"
FT                   /protein_id="ABO10989.2"
FT                   /translation="MTKQALLEVSNLVREFPAGESTIQILKGIDLTIYEGELVAIVGQS
FT                   GSGKSTLMNILGCLDRPTSGSYKVNGQETGKLEPDQLAQLRREYFGFIFQRYHLLGDLS
FT                   AEGNVEVPAVYAGVTPADRKQRATALLTELGLGTKTQNRPSQLSGGQQQRVSIARALMN
FT                   GGDVILADEPTGALDSHSGVEVMRILRELNAAGHTIILVTHDMQVAKNATRIIEISDGE
FT                   IISDRPNVPDQSLEEVKSDPDAAPALQNKQKKGKSISAWRSTLDRLSEAFQMALLSMNA
FT                   HRMRTFLTMLGIIIGIASVVTVVALGNGSQQQILSNISSLGTNTITVFQGRGFGDNSKT
FT                   ANFKTLVPADADALMTQPYVSAVSPMVSTSKTMRYQQNEANATINGVSNDYFDVKGLVF
FT                   KDGQTFDQRSVRDRSQDVVIDTNTQKQFFSDGTNPIGQVVLLGSVPARIIGIVEPQTSG
FT                   MGSDDTLNVYMPYTTVMSRMLGQAHVRNIVVRINDKYSTSAAENAIVNLLTQRHGAQDI
FT                   FTMNSDSIRQTIEKTTSTMTLLVSAIAVISLVVGGIGVMNIMLVSVTERTQEIGVRMAV
FT                   GARQSDILQQFLIEAILVCLIGGVLGVLLSLGLGQLINKFAGGNFAVAYSTTSIVAAFV
FT                   CSTLIGVVFGFLPAKNAAKLDPVAALSRE"
     atgacaaaac aagctttgct tgaagtcagc aatctggtcc gggaattccc tgctggcgaa        60
     agcacgattc aaattttaaa aggcattgac ctgaccattt atgaaggtga gctggttgct       120
     attgtcggcc agtccggctc tgggaaatca acactcatga atattttggg ctgtctggac       180
     cgcccaacaa gtggtagtta taaggttaat ggtcaagaaa ccggtaagct agagcccgac       240
     cagttagcgc agttacgccg tgaatatttt ggctttattt tccagcgcta tcatttactg       300
     ggtgacttat cagctgaagg taacgttgag gttccagctg tttatgctgg tgttactcca       360
     gcagaccgta aacagcgagc tactgccctg ctcacggagt taggtttagg tactaaaacc       420
     caaaaccgac caagccagct ttcaggtggt caacagcaac gtgtgtcgat tgcacgtgcc       480
     ttaatgaatg gcggcgatgt aatcttggcc gacgaaccaa caggggcact cgattcacat       540
     agcggcgttg aagtgatgcg aattttgcgt gaactcaacg cggctggtca tacgattatt       600
     ttggtaacgc atgatatgca agttgcaaag aatgcaacgc gtattatcga aattagtgat       660
     ggggaaatta ttagtgaccg tcctaacgtt ccagaccagt ctttagaaga agttaaatct       720
     gatccagatg cagcacctgc tttacaaaat aagcagaaaa aaggcaaaag tatttcggct       780
     tggcgttcaa ccctagatcg attatccgaa gcctttcaaa tggctttact gtccatgaat       840
     gcccaccgca tgcgtacttt cttaaccatg ctggggatca ttattggtat tgcctctgtc       900
     gtaacggtgg tcgcactggg taatggctct caacaacaga ttttgagcaa cattagcagt       960
     ttaggcacca acacaattac ggtattccaa ggtcgtggtt ttggtgataa ctccaagaca      1020
     gccaatttta aaacgctagt tcctgccgat gccgatgcat taatgacaca gccttatgtc      1080
     agtgcagtca gcccgatggt cagtacatcc aagaccatgc gttatcaaca aaatgaagca      1140
     aatgcgacta ttaacggcgt aagtaacgat tattttgatg taaaaggtct agtttttaaa      1200
     gacggccaaa cctttgatca acgaagtgtc cgcgaccgct cacaagatgt ggtgattgat      1260
     accaatacgc aaaaacaatt ttttagcgat ggtactaacc caatcgggca agtcgtgtta      1320
     ctgggtagcg taccagctcg tattatcggc attgtagaac ctcagaccag cggaatgggt      1380
     tcggatgaca cgctgaatgt atatatgcct tataccacgg tcatgagccg tatgttaggg      1440
     caagcccatg tccgtaatat tgtcgtacgt attaatgata aatactcgac cagtgctgct      1500
     gaaaacgcca ttgttaactt attaacccag cgccacggtg cccaagatat tttcaccatg      1560
     aacagtgaca gtatccgaca aaccattgag aaaaccacaa gtactatgac tctcttagtg      1620
     tcagcaattg ctgtaatttc tctggtagtt ggtggtatcg gtgtaatgaa tattatgctg      1680
     gtttcggtga ctgaacgtac gcaagaaatt ggtgtgcgta tggctgtggg tgctcgacaa      1740
     agtgatattt tgcagcagtt cctgattgaa gcaattttag tatgtttgat tggtggtgta      1800
     cttggcgtac tgctatcact tggcttagga caactgatta ataagtttgc cggtggcaac      1860
     tttgctgtcg cctattcaac cacatcaatt gttgctgcgt ttgtgtgttc aacattgatt      1920
     ggtgtcgtat tcggcttctt acctgccaag aatgcagcaa aacttgatcc tgttgcagca      1980
     ctatcacgag aataa                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page