(data stored in ACNUC29543 zone)

EMBL: CP000521.PE519

CP000521.PE519       Location/Qualifiers
FT   CDS_pept        complement(579240..580229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0539"
FT                   /product="putative DNA polymerase III delta subunit"
FT                   /note="HolA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10992"
FT                   /protein_id="ABO10992.1"
FT                   /translation="MKLDYLQALKRIPEARGAWILHGQEPLLEQNLLDTFRKSWQQQDI
FT                   ERQRYDISSVSDWKNVFNALNSLSLFSQQLAIEVHGNIKPDANGLKQLKSYIQHNETNL
FT                   LLIVLPKQDSSSLKSAFFQVVEANGVVVALTANYPQDRQRILAAEAEKLEIQLDNDAWQ
FT                   WLMQHHEHNLLAAKNSLMRVRDTFPDQKLIQIEQLYACLQDQSRYTTYDLSDALLEGNL
FT                   AQSIKIFQYLIGSGEPESLILWTLSKEMRLLMQLFEQPHNALQLGIWKTKVSLYQQALR
FT                   RLNPQQFLGWSALLLQIDAAIKGMSNENAQHLMQQAIAELCGKTLFIH"
     atgaaacttg actatttaca agccctcaaa cgcattccgg aagctcgggg tgcgtggatc        60
     ctgcatggac aggaaccttt attagaacaa aatttactcg acacttttcg caaaagctgg       120
     cagcaacaag acattgaaag acagcgctac gatattagta gtgtaagtga ctggaaaaat       180
     gtctttaatg cactgaacag cctatcttta ttttctcagc aacttgctat tgaagttcac       240
     ggcaatatca agcccgatgc caatggttta aaacagctaa aaagttatat ccagcataat       300
     gaaactaacc tgctgttaat tgttttaccc aaacaagaca gtagcagctt aaaatctgct       360
     tttttccaag ttgttgaagc gaacggtgtg gtggttgccc ttactgctaa ctatccgcaa       420
     gatcgtcaac gaatattagc cgctgaggct gagaagttag aaattcaact cgacaatgat       480
     gcttggcagt ggctcatgca gcatcatgag cataacctgc tcgctgctaa aaatagcttg       540
     atgcgggtaa gagatacttt tccagaccag aaactaattc aaattgaaca gttatatgcg       600
     tgtctacaag atcagtctcg ttacaccact tacgatttaa gcgatgcgct attagaaggt       660
     aatcttgctc agtccattaa gatctttcaa tatttaatcg gttccggtga accggaaagc       720
     ttgatcttat ggacattaag taaagaaatg cgtttattaa tgcagttgtt tgaacaacca       780
     cataatgcat tacaactagg tatatggaaa acaaaagtta gcttatatca acaagcatta       840
     agaagactca atccacagca atttttggga tggtctgccc tgcttttaca aattgatgcc       900
     gcaatcaaag gcatgtcaaa tgagaatgcc caacatttaa tgcaacaagc cattgccgag       960
     ctgtgtggaa aaacattatt tatacattag                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page