(data stored in ACNUC29543 zone)

EMBL: CP000521.PE524

CP000521.PE524       Location/Qualifiers
FT   CDS_pept        584438..586162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0543"
FT                   /product="acetolactate synthase III large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10996"
FT                   /protein_id="ABO10996.2"
FT                   /translation="MELLSGGEMLVRALADEGVEHVFGYPGGAVLHIYDALFQQDKINH
FT                   YLVRHEQAAGHMADAYSRATGKTGVVLVTSGPGATNTVTPIATAYMDSIPMVVLSGQVA
FT                   SHLIGEDAFQETDMVGISRPIVKHSFQVRHASEIPAIIKKAFYIASSGRPGPVVVDIPK
FT                   DATNPAEKFAYEYPEKVKMRSYQPPSRGHSGQIRKAIDELLTAKRPVIYTGGGVVQGNA
FT                   SALLTELAHLLGYPVTNTLMGLGGFPGDDPQFIGMLGMHGTYEANMAMHHADVILAIGA
FT                   RFDDRVTNNPAKFCPNSKVIHVDIDPATISKTIMAHIPIVGAVEPVLQEMLAQLKQLNV
FT                   SKPNPEAIAAWWSQINEWRKVHGLKYENPSDGTMKPQQVVETLYKVTNGDAIITSDVGQ
FT                   HQMFGALYYKYKRPRQWINSGGLGTMGVGLPYAMAAKLAFPDQQVVCITGEASIQMCIQ
FT                   ELSTCKQYGLNVKILCLNNRALGMVKQWQDMNYEGRHSSSYVESLPDFAKLMEAYGHVG
FT                   IQINHADELESKLAEAMAINDKCVFINVMVDRSEHVYPMQVAGQSMRDMWISKGERI"
     ttggaacttt tatctggtgg tgaaatgctc gttcgcgctc ttgcggacga aggcgttgaa        60
     catgtttttg gttatccagg cggcgcagta ttacatattt atgatgcgct atttcaacaa       120
     gacaaaatca atcattacct cgtgcgccat gagcaagctg ctggtcatat ggcagatgcc       180
     tactcgcgtg ctacaggtaa gacaggcgta gtactggtca cttctggtcc aggcgcaacc       240
     aatacagtaa ctccaattgc aacagcttat atggactcaa tcccaatggt ggttttgtct       300
     ggccaggttg catcacatct gattggtgaa gacgctttcc aggaaactga catggttggt       360
     atttcacgtc ctatcgtgaa acacagcttt caggtccgcc acgcaagtga aatccctgca       420
     attattaaaa aagcattcta tatcgcatca agtgggcgcc ctggtccagt tgtagtcgat       480
     attcctaaag atgcgactaa ccctgcagaa aagtttgcat acgaataccc tgaaaaagtg       540
     aagatgcgtt catatcaacc accttcacgc ggccactctg gtcaaattcg taaagcaatt       600
     gatgaattac taactgcaaa acgtcctgtt atttatacag gtggtggtgt cgtacaaggg       660
     aatgcttctg cgttattaac cgaacttgca catttacttg gttatccggt aactaacaca       720
     cttatggggt taggcggatt cccgggcgat gacccacagt ttattggcat gttgggtatg       780
     cacggtacat atgaagccaa tatggcaatg caccatgcag acgtaatttt ggcgattggt       840
     gcgcgttttg atgaccgcgt aacaaataac ccagccaagt tctgcccgaa ctcaaaagtg       900
     attcatgtcg atatcgaccc tgcaaccatt tcaaaaacga ttatggcgca tattccgatc       960
     gttggtgcag tagagccagt tcttcaagaa atgttggcac agttaaaaca attaaatgtg      1020
     tctaaaccaa atcctgaagc aattgcggct tggtggtctc aaatcaatga atggcgcaaa      1080
     gttcatggct tgaaatatga aaatccatct gatggcacta tgaagccaca gcaggttgtt      1140
     gaaactttat ataaagtgac caatggcgat gccattatta cttctgacgt aggtcaacat      1200
     cagatgtttg gtgcacttta ttataagtac aaacgtcctc gccaatggat caactcaggt      1260
     ggccttggca ccatgggtgt tggtttacct tatgcaatgg ctgcgaagct tgctttccca      1320
     gaccaacaag ttgtttgtat tacgggtgaa gcttcaattc agatgtgtat tcaggaactt      1380
     tcaacctgta aacaatatgg cttgaacgta aaaatcttgt gcttgaacaa ccgtgcatta      1440
     ggtatggtga aacaatggca agatatgaac tatgaaggtc gtcattcaag ttcttatgtt      1500
     gagtcattac ctgactttgc caagttaatg gaagcttatg gtcatgtagg cattcaaatt      1560
     aatcatgccg atgaacttga atctaagctt gcagaagcaa tggcaatcaa tgataaatgc      1620
     gtatttatca acgttatggt tgaccgtagc gaacacgttt atccaatgca ggttgcaggt      1680
     caatctatgc gtgatatgtg gatttctaaa ggggagcgca tttaa                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page