(data stored in ACNUC29543 zone)

EMBL: CP000521.PE525

CP000521.PE525       Location/Qualifiers
FT   CDS_pept        586162..586653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0544"
FT                   /product="acetolactate synthase isozyme III small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10997"
FT                   /protein_id="ABO10997.2"
FT                   /translation="MRHIISVLVENEAGALSRLVGLFSQRNYNIETLNVAPTEDPTLSR
FT                   LTLTTYGDDHKIEQITKQLNKLVEVVKVVDLSEGSHIERELMLIKVKALGASRAEIKRT
FT                   ADIFRAQIVDVTPTTYTIQIAGTTEKLDGFIDALAENTILEVVRSGVSGIARGEKVLAI
FT                   "
     atgagacata ttatttctgt actcgttgaa aacgaagctg gtgcgctttc tcgtttggtg        60
     ggcttattca gtcaacgtaa ctacaacatt gaaacactta atgttgcacc aaccgaagat       120
     ccgacattat cgcgtttaac gttaacgact tatggcgatg accataagat cgaacaaatt       180
     acgaaacagc tcaacaagct tgttgaggtg gtaaaagtag ttgatttatc agaaggttca       240
     cacattgagc gtgaactcat gctaatcaaa gtaaaagcat tgggtgcttc acgtgctgaa       300
     attaaacgca ctgcggatat tttccgtgcg caaattgtag acgtgacacc aacgacctat       360
     accattcaaa tagcagggac aactgaaaaa ttagatggtt ttatcgatgc gcttgcagaa       420
     aacaccattc ttgaagtcgt tcgttcaggt gtatcaggta tcgcccgtgg cgaaaaagtt       480
     ttagccattt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page