(data stored in ACNUC29543 zone)

EMBL: CP000521.PE527

CP000521.PE527       Location/Qualifiers
FT   CDS_pept        588033..590087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0546"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10999"
FT                   /protein_id="ABO10999.2"
FT                   /translation="MGHVDYDSTLIVGSFIAAGAICYIVISMEQLIFKQTYKKIEPFIL
FT                   LLNGLLLAAAISIVHIVGMHAYHLFEAASSNVPLITLAFGISAVLSSVAIWLTSRFTLP
FT                   IFRLILSSVIMGIGISASYYVSMLGWNIDIYKKDYTSFLILFSVLIAMSGSGLAFLLAY
FT                   KLKESERHRISLKLAFAVMMTLSIMGMHYTALISTNITDKFVSQYQAEHDLLLFTIILV
FT                   TCLVLVASFIVAVLEQRLNQRNLELRKANKELANLSIQDNLTKLPNRLYLVDYAEVLLS
FT                   DHRYKDQKIAFLYIDLDRFKSVNDAFGHHIGDQLLIQMANRLHWQLNEKCKLLRIGGDE
FT                   FLLIAENTDTEEAMQLAEKVLHLIQDSYQISGKEINISASLGIALFPEHGQNVQDLLMN
FT                   ADAAMLMSKEQGRNTYTVFSYSTHQQETRSQSKLINDLYKAVEEKQFVLYYQPKFNTNL
FT                   EICGVEALIRWNHPSLGMLTPHMFIGGAEKTGLIIPMGYWALEQACQQIQEWERSNTQF
FT                   YPIAVNLSALQFENKKLFSTLEGLLKKYQIQPHHLIIEITESTAMRHIDLSIRACERLR
FT                   DMGIRVAIDDFGTGHSSFLYLKDLPVDELKIDRGFIVDLKPGSKEEVILESIIHLAKKL
FT                   GLTVTAEGVETQQQVEILTRLGCQQFQGYLLGMPVNVGQLIQSQGAHFV"
     atgggtcatg ttgattacga tagcacattg atcgtcggct cttttattgc ggctggcgct        60
     atttgctata ttgtgatttc catggagcag ttaatattta agcaaactta taaaaagatt       120
     gagccgttta ttttattact caatggatta ttactcgcag cagcgattag tattgtccat       180
     attgtcggca tgcatgctta ccatttattt gaagcagctt cctcgaacgt tcctttaatt       240
     acactggctt ttggcattag tgctgtactt tcaagtgtcg caatttggct gacttctcgt       300
     tttacacttc ctatatttag actcatttta agctcagtca ttatgggaat tggaatttct       360
     gcttcttatt atgtgagtat gttaggctgg aatattgata tttataagaa agactacact       420
     tcctttctta ttttattttc tgtcttaatt gccatgagcg ggtcggggtt agctttcttg       480
     ctggcctata aattaaaaga aagtgaacgt caccgtataa gtttaaaatt agcctttgca       540
     gtgatgatga ccctaagtat tatggggatg cactatacgg cacttatttc gacaaatatt       600
     actgataagt ttgtaagcca atatcaggct gaacatgact tgctgctatt tacaattatt       660
     ttggttacct gtctggtact ggtcgcgagt tttattgttg ccgtgctgga acaacgactg       720
     aatcagcgaa atctagaact gcgtaaagcc aataaagaat tagccaacct ctctattcaa       780
     gataacttaa ctaaattacc aaaccgactt tatttagtgg attacgccga agtcctcctg       840
     tcagatcacc gttataaaga ccaaaaaatt gcttttctct atattgattt agaccgtttt       900
     aaatcggtaa atgatgcgtt tggacaccac attggtgatc aactgcttat acaaatggcc       960
     aatcgtttac attggcaact caatgaaaaa tgtaaattgc ttagaattgg tggggatgag      1020
     tttttactca ttgctgaaaa cactgatact gaagaggcaa tgcaacttgc tgaaaaagta      1080
     ttacatctta ttcaagacag ttaccaaatt tccggtaaag aaattaatat ttcagcaagt      1140
     ctaggtatcg cactgttccc tgaacatggg caaaatgttc aagacctgct gatgaatgcc      1200
     gatgctgcca tgctgatgtc taaagagcag ggccgcaata cttataccgt ctttagttat      1260
     tctacccatc aacaagaaac aagaagtcag tcaaaactga tcaatgattt atacaaagca      1320
     gtcgaagaaa aacaatttgt tctctactac cagccaaaat ttaataccaa tcttgagatt      1380
     tgtggggtag aagcactcat tcgctggaac catccatctt taggtatgct gacaccgcat      1440
     atgtttattg gtggcgcaga aaagacaggt ttaattattc caatgggata ttgggcgctt      1500
     gagcaagctt gccaacaaat tcaggaatgg gaacgtagca atacgcagtt ttatccaatc      1560
     gcagtcaatt tatcggcctt gcagttcgaa aataaaaagc tctttagtac tctcgaaggt      1620
     ttgttaaaaa aatatcaaat tcagcctcat cacctcatta ttgaaattac tgaatcaacc      1680
     gcaatgcggc atatcgactt aagcattcgt gcttgtgagc gactgcgcga tatgggtatt      1740
     cgggtggcaa ttgatgactt tgggacaggg cactcaagct tcttatattt aaaagattta      1800
     ccagtcgatg aacttaaaat tgaccgtgga tttattgtcg atttaaaacc gggctcaaaa      1860
     gaagaggtca ttttagaaag tattattcat ttggcgaaaa agttaggttt aaccgtaaca      1920
     gccgaagggg tggaaacaca gcaacaagtt gagattttaa cgcgcttggg ctgtcagcag      1980
     ttccaaggtt atttgttggg tatgcctgta aatgtagggc aactgattca gtcgcaaggt      2040
     gctcattttg tttaa                                                       2055
//

If you have problems or comments...

PBIL Back to PBIL home page