(data stored in ACNUC29543 zone)

EMBL: CP000521.PE53

CP000521.PE53        Location/Qualifiers
FT   CDS_pept        complement(59666..60766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0051"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10546"
FT                   /protein_id="ABO10546.1"
FT                   /translation="MKYCQFFSVLALSLSAASCAVTSGLQTYDIPSEGVYKTDLGTTVN
FT                   VVKISQETLPAIQPAQIDYQRDYASLFKNQQSIYRLSPGDVLSIQLWAYPEITPPVNNI
FT                   SNEQSIQANGYPIDQSGYIQFPLVGRYKAAGKTLAQVNRELHSQLARFLKNPDVVVRVV
FT                   SYEGQRFSVQGSVTKGGQFYLSDQPVSIYTALGMAGGVTTTGDNTYIQLIRNGRTYNLN
FT                   TIDLEKAGYSLHKLLVQPNDTIYVSTRENQKIYVMGESGKNQALPMRDQGMTLSDALGE
FT                   SLGINPNSASASRIYVVRTNPNDRTTEIYHLNLMSLGDFGLANQFRLRSNDIVYIDATG
FT                   LTRWQRVVNQIIPFSNALYNIDRLGQ"
     gtgaagtatt gccagttttt ctctgttctt gctttaagct taagtgctgc cagctgtgcg        60
     gttacttccg gtttacaaac ttatgatatt ccaagtgagg gtgtttataa aacggacctc       120
     ggaactacag ttaatgtagt taaaatttct caagaaacat taccggcaat tcagcctgct       180
     caaattgact atcaacgcga ctacgcatca ttatttaaaa atcaacaatc tatttatcgc       240
     ctaagtccag gtgatgttct ctctattcag ctatgggctt atccggaaat tacccctcct       300
     gtaaacaata ttagtaatga acaatctatt caagcgaatg gctatccaat cgatcagagt       360
     ggttatattc agtttccatt agttggccgc tataaagcag ccggaaaaac acttgctcaa       420
     gtcaaccgtg agttacatag tcaacttgct cgttttttaa aaaatccgga tgttgtagtt       480
     cgagtagttt cttatgaagg gcagcgcttc tctgttcaag gtagtgttac taaaggtggt       540
     caattttatt taagcgacca acccgtgagt atctatactg ctttgggtat ggcaggtggc       600
     gtcactacaa caggtgataa cacttatatt caactcattc gcaatggccg aacttataac       660
     ctaaatacga ttgatttaga aaaagctggc tattcactgc acaaactttt ggttcagccg       720
     aacgatacca tttatgttag tacacgtgag aaccaaaaaa tttatgtgat gggtgagtca       780
     ggtaaaaatc aagcactacc aatgcgtgat caaggcatga ctctaagcga tgctttaggg       840
     gaaagcttgg gcattaatcc aaactctgca agcgcaagcc gtatatatgt tgtacggact       900
     aatccaaatg accgcacaac cgaaatttat catttaaatt taatgagcct cggtgatttc       960
     ggcttagcta atcaatttag actacgtagt aatgatattg tttatattga tgcgactggc      1020
     ttaacacgtt ggcaacgtgt ggttaatcag attatcccgt tctcaaatgc tttatataac      1080
     atagaccgtt tgggacaata a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page